SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020781 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000020781
Domain Number - Region: 94-150
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0785
Family IP3 receptor type 1 binding core, domain 2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020781   Gene: ENSGMOG00000019315   Transcript: ENSGMOT00000021288
Sequence length 1196
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4248:516119:532422:-1 gene:ENSGMOG00000019315 transcript:ENSGMOT00000021288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLAHILTDPLGTREESNGQITEECMLGNCRVSLPEDLLEDPDVFFSVMSESTWTDVLS
DSQRHHLRQFLPQFPGNNVAVQDSAVSNLFNNQSFNFGNPLHLAQRLFRDGYFNPEVVKY
RQLCAKSQRKRRLYSLQQYYHRLLKQILVSRKDLLELAVHSGLDVPQKRPLNPRGQLEPQ
EPRIRRRVGRILREVKAECGDSNASSDDDSWPPAPQSPSSPTTSLPLRVLPSLSTQDMKT
AEKPELGVQDLKSMLQNHREKRKRHPDHPDLVTSDIHLGNMLSRVNIGRKGSSVAALFDL
ALPKKKIKEERRKKRLRTTVKLEAEDPCEALMTSDAAALSANHVPSLPDTPTPPPLANVK
EEVIEECQSSPAVVEEISISFFNLLESIMKTENLSSTSLLEEKVQTWQLSPATSLNPWFS
FASCWSELVLPALQFLAGEAKDGMMTLPTGFSPYVEFGDQSQQWRWIGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWTDYVVRPSTGDERHVFQIQEQQRYDQPHK
AFTFRMHGFESVVGPVKGVFDKEMSLNKAREHTLLRSDRPAYVTILSLVRDAAARLPNGE
GTRAEICELLKDSQFLAPDVTSAQVNTVVSGALDRLHYEKDPCVKYDIGRKLWIYLHRDR
SQEEFERIHQAQAAAAKARKALQQKPKPAPKPKSGSKEPGGKIQGSLEGGLESSPMSPIP
ATQSTPGTPKSPLPSTVGTPTKTGLPDMVKSSPGVLLVAPPSMPQLGSLLPSSQAPPAAQ
QPTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVSITGQLGVKTSVGGGGIPITATNLRIQGKDVLRLPPSSITTDSKGQTVLRITPDMMAT
LAKSPVATVKLSPDFLGSAGHGGGKSISATLHVTPPHSSSSSSSKAGHASSSLLKAGAAD
TAIRLMPTLAVTVGDQKTRTFSTHVSSASGDSKGAATIRIMPGLGVIPHKQGQTITMTTM
AGSKPLTVSAGPGTVTMAGALGAKGITVSASPLTIGTATGTVRHVPVTATVVTTGKLPTR
ITVPLSVLNQPLKTKSVVTSPMVKGSLNTSLSSLGRNIILTTMPAGTKLMAGNKPVSFVT
AQQLQQLQQQGQATQVRIQTVQTQQIQQHVATGSPKSVSTVVVTTAPSLKCPPDPS
Download sequence
Identical sequences ENSGMOP00000020781 ENSGMOP00000020781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]