SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020797 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020797
Domain Number 1 Region: 152-291
Classification Level Classification E-value
Superfamily EF-hand 4.99e-48
Family Osteonectin 0.000000509
Further Details:      
 
Domain Number 2 Region: 93-148
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000388
Family Ovomucoid domain III-like 0.0001
Further Details:      
 
Domain Number 3 Region: 67-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family Follistatin (FS) module N-terminal domain, FS-N 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020797   Gene: ENSGMOG00000019341   Transcript: ENSGMOT00000021304
Sequence length 292
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3505:1118:16347:1 gene:ENSGMOG00000019341 transcript:ENSGMOT00000021304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVWIVVALCLAGHAMAXXXXXXXXXXXXXXXXXXXXETTVGINPVQIETGEFDEAIQIE
EDFPAENPCLNHHCKKGKVCEIDEENNSPMCVCQDPSSCPAAAGEFEHVCGTDNKTYDSS
CHFFATKCALEGTKKGHKLHLDYLGACKFLETCVDAELSEFPLRMRDWLKNVLVTLFERD
EDNNLLTEKQKVRVQKIYENVKRLQSGEHSLDLLAHDFEKNYNMYIFPVHWQFGELDQHP
ADGFLTHTELAPLRAPLIPMEHCTTRFFDECDADSDKYIALEEWAACFGIKE
Download sequence
Identical sequences ENSGMOP00000020797 ENSGMOP00000020797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]