SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020841 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020841
Domain Number 1 Region: 8-484
Classification Level Classification E-value
Superfamily Sema domain 8.37e-158
Family Sema domain 0.000000000267
Further Details:      
 
Domain Number 2 Region: 480-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000575
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 551-617
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000158
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020841   Gene: ENSGMOG00000019371   Transcript: ENSGMOT00000021350
Sequence length 723
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2431:298450:317576:-1 gene:ENSGMOG00000019371 transcript:ENSGMOT00000021350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWQMNRTVVFQAQQGTLLQAQTMLLDEPNERLYVGAKNRLLSLRLEHINRDHKEIRWASS
ESQIEECLMKGREKPECANYIKVLQQYNSTHLLACGTGAFNPTCGLLAVGTKATDRLFSL
AEESVESGRGRCPYDPNSLCTSTLYRGELYIGVYTDYWENDGALCRLNSQTYTRTERDDR
QQLNQPKFIKSVVIPDNDDPEDDKVYFFFTEREQNPEGETKAVYTRVGRVCANDQGGRRM
LVNRWSSFLKTRLICSVAGANGIDTHFDELEDIFVLQNKDQKNPEIFGLFSTTSAVFKGY
AVCVYQMDDVRASFNGPFAQRERPGHHWTPYEDRVPYPRPGSCASKMNGGGFSSSKEFPD
EVLRFVRAHPVMYRAVQPLHRRPVLLQTQGGGRRLTQLAVDRVQAQDGHYHVLYIGTDDS
VVLKVITIYNKDTDTVEEVLLEELQVFQVPTTITEIIISSKKQQLYVGSEVGVAQVRLHQ
CELYGSQCADCCLARDPYCAWDGLTCSRYYPAGVYPKSRRFRRQDVRHGNAVQLCNGLQI
DDQQLGVAEERTVYGVETNSTLLECTPRSLQARVLWFRQQGELQHELQASERVVPTAHGL
LLLHVRGSDAGVYVCQTAEHGYVHALLRVALXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVWYKEFLQLIGYGDAQRVEEYCERVWCSDKKRKKPKRRYAPPG
GGG
Download sequence
Identical sequences ENSGMOP00000020841 ENSGMOP00000020841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]