SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020848 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020848
Domain Number 1 Region: 304-493
Classification Level Classification E-value
Superfamily Sema domain 1.7e-67
Family Sema domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 154-265
Classification Level Classification E-value
Superfamily Sema domain 1.35e-35
Family Sema domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 28-110
Classification Level Classification E-value
Superfamily Sema domain 0.000000000000106
Family Sema domain 0.0000195
Further Details:      
 
Domain Number 4 Region: 578-665
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000001
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020848   Gene: ENSGMOG00000019379   Transcript: ENSGMOT00000021357
Sequence length 788
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2431:343936:377691:-1 gene:ENSGMOG00000019379 transcript:ENSGMOT00000021357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTRGSVLLLLWGLVLLTGAQTSRSNVPRLKLSYKEMLQSNNLVTFDGLANSSAYHTFL
LDEEKGRLVVGAKDHIFSFNLLNISKDYSQIAWPPSTARRDECKWAGKDLSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXQDNLFRLGPFIENGRGKSPYDPKLFTASMLIDGE
LYSGTSADFMGRDFAIFRTLGKHHPIRTEQHDSRWLNEPRFVSVHLIPESDNPEDDKIYL
FFRESAIDGEHAGKATHARIGQLCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDVFLMSTKDPKNPIVYTVFTTSSNIFKGSAVCLYSMVDIRRVFLGPYAHRDGPNYQ
WVPFQGRVPYPRPGTCPSKTFGGFDTTKDLPDDVVTFARSHPAMFHPVYPINNKPIMVKT
DVDYQFTQIVVDKVEAEDGQYDVMFIGTDIGTVMKVVSVPRGSWHDLEEVLLEEMTVFRE
PTAITAMELSTKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXELNGQTTMLEKRVYGVENSSTFLECSPKSQR
AVTSWSYQKTSGGDRKQEVKAEERFVRTEQGLLIRTLARGDSGLYLCQAVEHGFMQTLVR
VALEVIVTERLEDMLHRAXXXXXXESPNQKLWYRDFLSLVDHPTLNSVDEFCEQVWKRER
KHKRQKAQLLQQGQIQQQQQQQQEQAVHAHGPHVHAHGLASAKWKHLQDRQKGRNRRTHE
LERAPRSV
Download sequence
Identical sequences ENSGMOP00000020848 ENSGMOP00000020848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]