SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020856 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020856
Domain Number 1 Region: 46-531
Classification Level Classification E-value
Superfamily Sema domain 2.62e-172
Family Sema domain 0.0000000000347
Further Details:      
 
Domain Number 2 Region: 527-578
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000523
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020856   Gene: ENSGMOG00000019387   Transcript: ENSGMOT00000021365
Sequence length 770
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2431:423289:522449:-1 gene:ENSGMOG00000019387 transcript:ENSGMOT00000021365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSTEGAAGGRSWTASHPRLLFLGLLPLLLLGAPLPSAASASLQGVPRVTLSHKELVQSG
SVSVFMGASGGLHSHTLLLDEEKGRLLLGARDHVYLLDPDNLSRAPRKRVKMCKLAGKNV
NLECANFVRVLHNYNHTHVYACGTGAFHPTCAFIELTGHRESGVFQLLPSSFESGRLKCP
FDPRQPFTSVLTDQYLYAGTASDFLGKDTTFTRSLGPPPDQNYIRTEISEDYWINEASFI
SAHPMSDTHNPDDDKIYFFFREVSREGKDKSILSRVARVCKNDVGGLRSLTNKWTTFLKA
RLVCSIPGPDGVDTHFDELQDIFMLPTRDDKNPVVYGVFTTSSSIFRGSAVCVYSMADIR
AVFNGPYAHKEGPDHRWVEYEGRIPYPRPGTCPSKTYDAKIKTTKDFPDEVVSFVRFHPL
MHGSVLPLNGRPVFQLVRAEYTLTQIVVDRVSAEDGQYEVMFLGTDAGSVLKVVSIAQEN
WSREEVVLEELQVFQVPTPILSMEMSFKQQQLYVGSSEGLAQVSLSRCPLYGQGCSECCL
ARDPYCAWDGTTCSRYVPAAKRRARRQDVKHGDPASQCWDSADGGGLAEERVLFGVQNNS
TFLECIPKSQQAQIRWYIQRPGVEHRDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPRPGEDPGAEPRSGAESRQRYKDYLRVMNSPVGSL
EEYCATLLVKKQPIKARGRGMGAGKWKHIQELKKSRNRRQREEGGRARRA
Download sequence
Identical sequences ENSGMOP00000020856 ENSGMOP00000020856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]