SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020859 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020859
Domain Number 1 Region: 224-400
Classification Level Classification E-value
Superfamily MIR domain 3.27e-45
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 428-557
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000118
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 3 Region: 3963-4041
Classification Level Classification E-value
Superfamily EF-hand 0.00000162
Family Polcalcin 0.089
Further Details:      
 
Domain Number 4 Region: 107-190
Classification Level Classification E-value
Superfamily MIR domain 0.00000615
Family MIR domain 0.026
Further Details:      
 
Domain Number 5 Region: 667-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000712
Family SPRY domain 0.061
Further Details:      
 
Domain Number 6 Region: 2129-2200
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000111
Family IP3 receptor type 1 binding core, domain 2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020859
Domain Number - Region: 1430-1547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000111
Family SPRY domain 0.04
Further Details:      
 
Domain Number - Region: 1087-1134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00148
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020859   Gene: ENSGMOG00000019367   Transcript: ENSGMOT00000021368
Sequence length 4863
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2236:168:113345:-1 gene:ENSGMOG00000019367 transcript:ENSGMOT00000021368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGDGEEEIQFLRTDDQVVLQCTATVLKEQIKLCLSCEGFGNRLCFLETTSNAQNVPP
DLAICSFILEQSLSVRALQEMLAHRVEMIDTVDLDQWSSQGGGHRTLLYGHAILLRHYHS
SMYLSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSV
SSERYLHLSYASGDLMVDASFMQTLWNMNPVCSGCELAEGFLTGGHVLRLFHGHMDECLA
ISTPEEGEEKRRMAHYEGGAVCSQARSLWRLEPLRICWSGGHMKWGMSFRVRHITTGRYL
CLDEEKGLVVVDPERANTKMSAFSFRATKEKSDVAQKRDVEGMGIPEIKYGESMCFVQHV
STGLWLTYAALDAKAARLGTMKRKTILHQEGHMDDALTVSRSQTEESQAARMIFSTTGLF
RHFIKGLDSLKAKSKAPGPVNLPLEGVILSLQDLIFYFRPPEEELEHEEKQTKLRSLRNR
QNLFQEEGMITIVLECIDRLNIYNTAAEFSEFAGEEAAESWKEIVNLLYELLASLIRGNR
SNCALFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHG
RNHKVLDVLRSLCVCNGVAVRSNQNLITENLLPGRDLLLQTNIVNYVTSVRPNIFLGTCE
GSTQYKKWYFEMMVDQVEPFVTAQASHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSY
GFDGLHLWSGTVPRQVASPNQHVLAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNVD
GLFFPVISFSAGIKARFLLGGRHGDFKFMPPPGYAPCYEALLPKDRMRIEPIKEYKHDYN
GVRNLLGPTQSLTHTSFTPCPVDTVQIVLPPNLERIREKLAENIHELWAVTRIEQGWTYA
SFRDDNKKLHPCLLDFHSLPEPERNYNLQMSAETLKTLLALGCHVGMGDEKAEENLKKIK
LPKTYVMVNAYKPAPLDLNHVKLTPNQNQLVEKLAENGHNVWARDRVRQGWTYSIVQDIL
NKRNPRLVPYVLLDERTKKTNRDSVNNAVRTLIGYGYNIEPPDQESTGHGLENMRGDKVR
IFRAEKSYAITQGKWYFEFEAVTTGEMRVGWARPSVHADTELGADELAYVFNGNKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIPVCT
LGLSQVGRINLGQNVSSLRYFAICGLQEGFEPFAINMKRDITMWFSKSLPQFEPVPTSHS
HIEVSRVDGTVDTAPCLKINHKTFGSQNANTDMLFMRLSMPVQFHEVFKVTAGTTPLTHA
LTIPEEEVGVVKEPDSEFEVLKKSASRKEQEEDKKEPSVAREVTSENEKDTLSEKGKKKG
FFAKTKKAAMTTLSPPPAPPTVPRLMEDVVPDDRDDPEIILNTTTXYYSLRIFAGQEPSA
VWVGWVTPDYHMYDPSFDLTKVRNVTITVGDDRGNIHDSMKHSNCYMVWGGDLVSNQQTR
FSQEDMVVGCLVDLATGLMTFTANGKEINTFYQVEPNTKLFPAVFVQPSSQNMVQLELGK
LKNIMPISAAMFRSERMNPVPQCPPRLDVQMLTPVIWSRMPNHFLNPRVGRISERLGWVV
ECVEPLIMMALHIPEENRCIDILELSERQDLMKFHFHTLMLYCAVCALGNNRVAHALCSH
VDESQLFYAIENTYLPGPLRSGYFDLLISIHLESAKRARLGTNREFIVPMSEQTLSIKLY
PDEEKAHSLPGVGLTTCLRPKLHFSSINFVGTDPDLYTLSPVFPLQELKTKAISMLTEAV
LDGSQAMRDPVGGSVEFHFVPILKLISTLLIMGIFNDEDSQHILKMIEPSVFGASRGGLL
QMKLPESVKLQXXXXXXXXXXXXXXXXVEGIVAFSDYFVKEIQSDQRIRYNLLMRAFTMS
AAETARKTREFRSPPQDQLILLTNFKNNPEEEDCPVPEEVRDKLAEFHNDLLLHCGIVIE
GEAEEVEVDTSLRGRLNSLVEKVKTLRKKKEEEEEPEVKEETKPGTLQELISHTMIHWAQ
ESFIQNPELVRMMFSLLHRQYDGLGELIRSLPKAYAINAISVQDTMDLLECLGQIRSLLI
VQMGPEEERLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGGDSKEIRFP
QMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLGMGGSTPLDVAAASCIDNNEL
ALALQEQELEMVVTYLAGCGLQACPMLLGKGYPDIGWNPCGGERYLDFLRFAVFVNGESV
EENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDRRFMFG
GEEQHEEHRVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDL
VGVISLPVQIPAFGKDGIILEPKMSASFVPDHKASMVLFLDRVYGIDNQDFLLQLLEVGF
LPDMRAAASLDTASFSTTEMALALNRYLCSAVLPLITKCAPLFAGTDHRAIMIDSMLHTI
YRLSRGRALTKAQRDIIEECLMSLCKYLRPSMLQHLLRRLVFDVPILNEHAKMPLKLLTN
HYERCWKYYCLPNGWGNFGVTSEEELHLTRKLFWGIVESLAHKKFDAELFKIAMPCICAI
AGAIPPDYVDASFSVTEKKASVDAEGNFDPKPVETTNTIIPERLDGFINKFAEYTHDKWA
FEKXXXXXXXXXXXDENAKTHHMLRPYKTFSEKDKEIYRWPIKESVKAMLAWEWTMDKSR
EGEVEVEKTTATRKISXXXXATYDPSHGYNPQPIDITAMALSRELQSMAEQLAENYHNTW
GRKKKMELMSKGGGTHPLLVPYDTLTAKEKARDREKAQDLLKFLQLNGYAVTRGPKDMEQ
DISSIEKRFAYGFLQKLLKWMDIAQEFIAHLAEAVVSSGRVEKSPHEQEIKFFAKILLPL
INQYFKNHCLYFLSTPAKVLGSGGHSSNKEKEMIFCKLAALVRHRVSLFGTDAGAVVNCL
HILSRSLDARTVMKSGPEIVKACLRQFFECAADDIEKMVENLKLGKVSSRNQVKGVSQNI
NYTTIALLPVLTTFFDHIAQHQFGDDVIPSVDDLQISCYRIMCSIYSLGTVKTPHVEKQR
PALGECLANLAAAMPVAYLEPSLNEFNAFTVYTTKTPRERSILGLPNQVEELCPDIPELD
ILIKEISELSESGARYTEMPHVIEITLPMLCNYLPRWWERGLENFPELEGQICTGVTSEQ
LNQLLGSIMKIVVNNLGIDEASWMKRLAVFAQPIVSRAKPEMLKSHFIPTMEKLKKRTGK
VVAEEEHLRMEGKSEVDSEDGTIRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDA
EELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKGGGDGESGDSG
QERSKKKRRGDRYSVQTSLIVAALKKMLPIGLNMCSPADQELINLAKIRYSLKDTDEEVR
EFLQNNLHLQGKVEDPAMRWQMSLYKEMSGKAEDAEDPEKVVKRVQEVSAVLYHIEVXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRGSNMFLDGYKRNWLMTEGYSFED
MMIDDLSQEAKPDPLHQLILHFSRTALTEKTKLDVDHLYMSYADIMAKSCHMGEEDEGQC
EEGEEPAFEDKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGEPGAMVSSTLKLGISIL
NGGNCDVQHKMLEYLKDKKDVGFFLSIQALMQTCSVLDLNAFERQNKAEGLGMVSEEGSN
EKVMSDDEFTCDIFRFLQLMCEGHNNDFQNYLRTQTGSTTTINVIICTVDYLLRLQESIS
DFYWYYSGKDIIDEPGKRNFSKAMTVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVG
FLHVFAHMMMKLAQDSSQIGLLKELLDLQKEMVVMLLSLLEGNIVNGTIARQMVDMLVES
SSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFSKAMDSQKQYSPSEIQFL
LSCSEADENEMINFEEFADRFQEPAKDIGFNIAVLLTNLSEHVPHDTRLQNFLGQAESVL
NYFRPFLGRIEIMGASRKIERIYFEISEANRNQWEMPQVRESKRQFIFDVVNEGQESEKM
EMFVNFCEDTIFEMNIAASISEPEPEAEEDDGGNEVESGDGDEANGEEKPPESSSAFADF
LKSVVLFLNMFTFRNLRRKYRKLRKMTVKEIVVALVTFIYTVLMGVLLFVYSVCKGFFTL
IWKVLFGGGLVEGAKKMTVTEILASMPDPTQDEVHGDLPPEPGARVVQDADGAGDQESAE
GEEQEEDREERGEGSQAGPEKPGGLGDFGETTLEEPPTPEGTPLLKRKLQAAARSGEGAD
GGEPQPEAEVAPETEKASAENGEKEKAVPEVEVKAEEPEPEPEEEVVKTKPKKEKKSAGE
GFELWNELDVQRNKFMNYLSRNFYNLRFLALFVAFALNFILLFYKMFEGPLCSRGPFEGS
ALFEGSAAFDGSGAEEDGSGMDGEGEEEEEEEGPVFFFLEESTGYMQPTMSFLAVFHTVI
AVLCIIGYNCLKVPLVIFKREKELARKLEFDGLYVTEQPEDDDIKGQWDRLVLNTPSFPN
NYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSAMTHEKKPEPDSSMFSWITAID
IKYQIWKFGVVFTDNTFLYLCWYMLTSLLGHHNNFFFAAHLLDIAMGVKTLRTILSSVTH
NGKQLMMTVGLLAVVVYLYTVIAFNFFRKFYNMSEDEDEPDMKCDDMMTCYLFHMYVGVR
AGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVRE
DME
Download sequence
Identical sequences ENSGMOP00000020859 ENSGMOP00000020859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]