SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020907 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020907
Domain Number 1 Region: 269-496
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.12e-59
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 20-171
Classification Level Classification E-value
Superfamily Flavoproteins 2.72e-42
Family Cytochrome p450 reductase N-terminal domain-like 0.09
Further Details:      
 
Domain Number 3 Region: 528-701
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.62e-35
Family NADPH-cytochrome p450 reductase-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020907   Gene: ENSGMOG00000019435   Transcript: ENSGMOT00000021419
Sequence length 702
Comment pep:novel genescaffold:gadMor1:GeneScaffold_655:7579:33968:1 gene:ENSGMOG00000019435 transcript:ENSGMOT00000021419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAGRARPIFPRMPCEKQPRFLILYGSQKGQAQSIAEGIADEAAEHGLVAEISCLSRHEE
YRLERESAPVVFIVSTTGDGEPPDTTLKFVKTIRAKTLPSDFLKNLQYTLLALGDTNYAN
FCNCGKTIDKRLQELGANHFYATGHADDGTGLEVVLDPWIEGVWDAIKAALSKMSSSSAT
KKPSVTPRKTPPTSPPHVELNRLSLGLSSESAWLLLSAQEAQTAGQRSVWLTSLTYSLPP
LSQSSLNVPALPPPYLEVTLLLEDKAEKETFYEVPVTNAVQMTRGDSVKKALLLELDISA
HPTMTYMPGDSFDVLCPNRASEVDAVLLRLGLQDQKHQRVQLAVRRDTQKRGAQTPPHVP
DNCTVQYLLTWCLEIRSVPKKAFLRALVDCAGDSGQKRRLQELCSKQGSADYNRFIRDSS
LCLPELLTEFSSCTPPLSLLIEHLPKLQPRPYSAASSTLRHPGRLRFIFTVVELPACPGR
PEGRRGLCSGWLADLVAPVLVCPGTDESSCGQAQLPQIHVRMRPSGTFHAPTDPTAPLIM
VGPGTGLAPFLGFLQQRGKRRDSPEVAFGETWLFFGCRHKDGDYLFXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVPAVSQPPPACPRYVQHNLRLHSQRVSRLLLRHDARLYVCGDARNM
AKDVNDTLMEMVRAELQLDQLGAMKTLAALREEKRYLQDIWG
Download sequence
Identical sequences ENSGMOP00000020907 ENSGMOP00000020907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]