SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020909 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020909
Domain Number 1 Region: 967-1121
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-17
Family DBL homology domain (DH-domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 1136-1195
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000043
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020909
Domain Number - Region: 585-675
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020909   Gene: ENSGMOG00000019429   Transcript: ENSGMOT00000021421
Sequence length 1273
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4197:80:107877:-1 gene:ENSGMOG00000019429 transcript:ENSGMOT00000021421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSEAVEDCVQGALSSLYPPFESTAPPLLSQVFSVLESTYQHDSLRYLLDYFVPAKHLLYK
LQQHACSQYLGCLFLHSGWPLCLGEKVVVQLSTLDWRLLRSTDFYLQVVPFSTRCPRLAL
KCLAPGGRTVQEILVPESQHPLVFTTEWLHSVNRERVGGGLDTCLVSTCDGVVRLPWKEV
VYPKFIHDPTEDPGLMSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVE
LLEPRGGPDGGADARQGYLEMHAISKTKTLPLCRRSYAIKLKRGKAWGYGKAEGSGSFRN
VIGGKNSVFEDADKPLSGDSDSTTPTSEAPERGRERGPKEGLAPVAVATKKLLKLCLKLH
PLPARPSSAKPPITKDSQLEIRSLVDDKEQTSSNQGAEETQPRKGSTGNPSSRPIREPVC
SPAPPEGTGLFVTVWEIQAIRLVRDARPILCYASNSGTVDRLGRALVVTETHVPEEGYSA
EEMARVLSCYHRITRPAAKEKGLTVLIDSRQSPPSPLFLSALNHFQVLVPGGLGSVLVLL
EEQQDATALELEPLEQYVDRQQLLTDMGGDFSHAHADWLLFRLSLESLTERCEGALSLLG
EALRSMDAEPMPDNIKAVPLSIEKHRGLMMDVLADQRLTELQQRGGAWLAGLTNSTPLRA
ALAATSDLYESVDDALHRLVRVSNQRGCDLEALGRLAALVDKLEKEIREVQSQLEEYKDP
PLSLSRLSVKQHKFKSFRETANXXXXXXXXXXXXXXXXLSHRWSCLDNTQRLLTTLTEVX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVLIRGVEVSSKEVVDHTGSPRQHVLLGRMEREMGGR
EGGPTTQRMLSAERQYVAVLKGAQETFLPLLELPDTPAALRGKADALFPCWAGLSSFHAQ
YLLPAMEGALLQSLLQHDCFSKYSDHFLQYSHYIRTKPELDSPLTKLPPSSPLFPMAFPR
CLHAPLQRLEQYCHALQELGGLNSASDSALSMLRHAQRHGEDLRASDLIVGCPVCVSERG
DLVRQGELVVCGGAGARRKKGGVRTVFLYQNILIFTKRRTSAPRTTYTHKHHIKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCLKE
SLCMGMSSKLLLD
Download sequence
Identical sequences ENSGMOP00000020909 ENSGMOP00000020909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]