SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020916 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020916
Domain Number 1 Region: 3-457
Classification Level Classification E-value
Superfamily Sema domain 9.94e-121
Family Sema domain 0.000000371
Further Details:      
 
Domain Number 2 Region: 807-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.35e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 562-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000288
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 753-805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000811
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 5 Region: 453-504
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000102
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 616-668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000863
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 7 Region: 866-910
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 506-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020916   Gene: ENSGMOG00000019444   Transcript: ENSGMOT00000021428
Sequence length 1042
Comment pep:novel genescaffold:gadMor1:GeneScaffold_655:74846:160974:-1 gene:ENSGMOG00000019444 transcript:ENSGMOT00000021428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVIILTEMEPWIFRFKAEGTVDFSQLTFDPGQNELIVGARNHLFRLSLEDLTLIQGAEWH
CDEFTKGACFSRGKSEEECQNYIRVLLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQI
SGMARCPYNPRHNSTALITSAGELYAATAMDFSGRDPAIYRSLGGMPPLRTAQYNSKWLN
AEPNFVSSYDIGNFTYFFFRENAVEHDCGRTVFSRAGRVCKNDIGGRFLLEDTWTTFMKA
RLNCSRPGEIPFNYXXXXXXXXXXXXXXXXXXXXXXXNSIAASAVCAFNLSAVTQVFSGP
FKFQENSRSAWLPFPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFLLMHEVVQPVVPVPY
FMEDNVRFTHVAVDVVQGKDQLFHIIYLATVDYGTIRKVLSPLNQSMGNCLLEEIELFPP
RKRQHIRSLLILHSRSELYVGVRDQVLKIPLKRCNYHKTRESCVGARDPYCGWDLVLKKC
TTLEQSVRMSQWEQSITKCPVRNVTVDGGYGAWASWAACSHNDGGSGGACLCRTRACDKP
APQCGGQSCQGISVEVANCSRNGAWTPWTLWSPCSTSCGIGFQVRQRSCSNPTPRHGGRV
CVGQNREERYCNEHLPCPAHVYWSAWSAWERCTVPCGGGIQSRRRTCENGNECPGCSQEY
QSCNTAPCPDLKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARVAEASLLEVGRQRIEMR
YCSSDGSTGCSTDGEGRGGGEVLRLGRLSGHAVSGGWTPWSSWAQCSRDCSRGVRSRKRS
CSNPEPKYGGQTCMGAAQEYQECNVTPCPVDGSWSCWSSWSRCSVTCGGGHYMRTRTCSN
PPPAHGGDICLGLHTEEALCNTQPCPESWSSWSDWSQCEGAVSQMRVRHCDVLFPTGNQC
SGNSTETRPCPPDSNXXXXVSIARSSQEEIYCGDFNLFHMMAVGLSSSILGCLVTLLVYS
YCQRYQQQSHDATVIHPVSAPLNTSITNHINKLDKYDSVEAIKAFNKNNLLLEERNKYFN
PQLTGKTYTNSFFTDLNTYDDY
Download sequence
Identical sequences ENSGMOP00000020916 ENSGMOP00000020916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]