SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020938 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020938
Domain Number 1 Region: 1137-1279
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-52
Family Phosphotyrosine-binding domain (PTB) 0.00000117
Further Details:      
 
Domain Number 2 Region: 35-201
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.42e-28
Family Dual specificity phosphatase-like 0.0002
Further Details:      
 
Domain Number 3 Region: 1004-1135
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-22
Family SH2 domain 0.002
Further Details:      
 
Domain Number 4 Region: 203-330
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.92e-22
Family PLC-like (P variant) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020938   Gene: ENSGMOG00000019453   Transcript: ENSGMOT00000021450
Sequence length 1282
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3650:394426:414174:-1 gene:ENSGMOG00000019453 transcript:ENSGMOT00000021450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQKGSITSTFQKKRGSLPRSKSVELVMEQVMERHYDFDLTYITERIISVFFLPDLEEQRY
RGNLQEVAAMLKSKHQDKFLLLNLSEKRHDIASLNPKVQDYGWPDHHAPPLDRICAVCKA
MDTWLISDPQNVVVLHCKGNKGKTGVIVAAYMHYSKITAGADQALTTLAMRKFCEDKVSS
SLQPSQNRYIFYFGGLLSGSIKMNSSPLFLQQILIPSLPNFQAEGGYYPFLKIYQSLQLV
YTSGVXXXXXXXXXXXXXXXXXXXXXXXXXXVKCYHRRPRGAQREVVFRVQFHTCTVHGA
QLWFGKTELDSACSDDRFPPDNSVEFIFSSSPDKIKGREYQKNEPSITVDYNTSDPVVRW
DSYENFNLHHQDSLETEIPHTRGPLDGSLYAQVRKRRGPGSTGAVRLSLSPTVGPPAGRR
SAASRLLQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXRECSPEGCHLVHCPGHGPPSLPTSPYRELFFQPPAAPSGCGCRDCAGRREH
QSASVRLFHPLHSDKSGGLQWGREVEMQQAREGPPVWADSHWEAKREAAEFWQHKTAVQP
YRVCHSSLEQPEPGPSRVCPIGYRTPPPAHLACACIPYQSSPAESHESRGYASGYQSGSS
SPLAPTSPMPGASPGRVRQRRALPEPGARQNTHHTAEDQTAQADAKDNKSVSPSSDPDSA
AGMDVDQDYTLICSSGLTDRHIDHSAKESGQSDTSSQTTVTIQSVTKVQVQLNGSALPGD
AQGSDTASRDASSGSSTPASAQSPQGSPARGSSPQAGPDRPPAGTARPSRPNPSPVPEGY
STPTFPLASYYYPLLNVPHVPYTGYTAVTIPAPQPPLPEKKRFSSSPLALNGHSSLLRAE
SAPSSAHHVTFSPSVAEPPALGRRGSAQSGGREEADTKVNAKFVQDSSKYWYKPGISRDQ
AIAVLKDKEPGSFLIRDSNSFQGAYGLALKVTTPPLNANLNTSKGDPLEQLVRHFLIETG
PRGVKIKGCQNESYFGSLSALVYQHSITPISLPCALLVPDKDLVGELQEIQSVTNTSTAA
NLLKQGAACNVLYLNSVETESLTGPQAISKATKCTLALSPRPTATVVHFKVSIQGITLTD
GKRRLFFRRHYPINSVTFSSLDPKDQRWTNSNSTSSKIFGFVARRTGSTTENVCHLFAEI
DPEQPAVAIVNFINKVMLGPQL
Download sequence
Identical sequences ENSGMOP00000020938 ENSGMOP00000020938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]