SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020946 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020946
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily EF-hand 2.67e-39
Family EF-hand modules in multidomain proteins 0.004
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily EF-hand 5.29e-31
Family EF-hand modules in multidomain proteins 0.0039
Further Details:      
 
Domain Number 3 Region: 219-300
Classification Level Classification E-value
Superfamily RING/U-box 6.95e-20
Family ZZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020946
Domain Number - Region: 405-482
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020946   Gene: ENSGMOG00000019472   Transcript: ENSGMOT00000021458
Sequence length 562
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2306:22247:50620:1 gene:ENSGMOG00000019472 transcript:ENSGMOT00000021458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEEGSKRSKAMVEKRQLFMEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDVWNMIE
AFRDNGLNTLDHNAEINVSRLETILSSIYYQLNKRLPTTHQINVEQSIGLLLNFMVAMYD
SEGHGKLTVFSMKAMLATMCGGKIVDKLRYNFSQISDSNGVMIFAKFDQFLREVLKLPTA
VFEGPSFGYTDHSVRTCFPQQKKILLNTFLDILMADPPPQCLVWLPLMHRLANVENVFHP
VECSYCRSESMMGFRYRCQQCHGYQLCQSCFWRGHANGPHSNQHQMKEHSSWKSPAKKLS
HAISKSLGCVPMGEAPHPLFPEQAERPQETHTHNVQPKSAAHNMNDTLIMSTGAPTPTKS
VLESPSRLDEEHRLIARYAARLAAEAGNSTQQCPPTDLSFNFDANKQQRQLIAELEHKNR
EILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRHRKDELERRMSALQESRRELMV
QLEGLMRLLKSQSGGSPHSSPSHGAGCSMPMPIRSTSAGSTPTHTPQDCLAGVGGDVLEA
FAQVDDLVEEEEANMRNGRERG
Download sequence
Identical sequences ENSGMOP00000020946 ENSGMOP00000020946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]