SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020964 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020964
Domain Number 1 Region: 12-143,172-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-76
Family Calponin-homology domain, CH-domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 8017-8171
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 6936-7078
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 3329-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 5 Region: 7388-7519
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 7797-7920
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-16
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 2673-2796
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 8 Region: 8320-8484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 9 Region: 4504-4661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000394
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 10 Region: 7054-7193
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 2399-2514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000972
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 12 Region: 2244-2392
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 3884-4025
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000475
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 1402-1544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000615
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 5044-5202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000166
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 16 Region: 7924-8034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000245
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 17 Region: 6748-6865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000336
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 18 Region: 4285-4442
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000072
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 19 Region: 8446-8588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000117
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 20 Region: 3805-3920
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000275
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 21 Region: 558-697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000276
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 22 Region: 2031-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 23 Region: 5705-5797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000824
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 24 Region: 3060-3171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000876
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 25 Region: 2835-2943
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000252
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 26 Region: 3563-3695
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000331
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 27 Region: 7704-7808
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000345
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 28 Region: 7261-7381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000422
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 29 Region: 1939-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000523
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 30 Region: 4621-4769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000561
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 31 Region: 5903-6037
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000111
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 32 Region: 6519-6601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000263
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 1504-1619
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000464
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 3169-3278
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000117
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 35 Region: 875-1013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000051
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 36 Region: 3457-3545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000681
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 1640-1758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000072
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 1074-1219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000875
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 39 Region: 7625-7743
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000109
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 40 Region: 4956-5048
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000224
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000020964
Domain Number - Region: 3667-3792
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000106
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number - Region: 5171-5288
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000112
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 3997-4131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000221
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number - Region: 4874-4985
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000245
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number - Region: 5293-5417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000259
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 7523-7636
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 6341-6439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00317
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 2514-2609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0072
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 1230-1340
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00878
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 5591-5684
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00944
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1303-1401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0119
Family Spectrin repeat 0.025
Further Details:      
 
Domain Number - Region: 4743-4872
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number - Region: 6646-6758
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0166
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 2592-2662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5474-5589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020964   Gene: ENSGMOG00000019433   Transcript: ENSGMOT00000021476
Sequence length 8735
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2375:182291:333933:1 gene:ENSGMOG00000019433 transcript:ENSGMOT00000021476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSRPFKRPSLDNIANVMQKLQDEQEAVQKRTFTKWINSHLAKHKPALEVNDLFEDIKD
GVKLLALLEVLSGQRLPCEQGRQIKRIHWVSNIGTALRFLEGRRIKLVNIHATDIADGRP
SIVLGLIWTIILYFQIEELTSNLQAAEGLSTSNSSVDSMASSETGSPPVKRKQRLQGNAK
RSLLRWVQSMAAKRQGIEVKDFGPSWRSGVAFHAVVHAIRPDLVDMELVRRRSNRDNLEE
AFSLAENQLGIPRLLEPADVDVDKPDEKSIMTYVAQFLKHYPNPHTDSQQDQLKILLGTI
PTFALSVPVLQREERKALRELKVFLDQLERDILRAQGAEGNLTXXXXVFKSFRVQYEMKK
KQSEALLQPMQRDGKLSVEQALVKQAXXXXXXXLLDWHIHLDKSLPGPLGVMGAWLHRAE
IALREEIPIHQAHEETANGVHRKLEQHKEVLMNLESHRQTFQQIHRDRSVNGVPVPPEQL
QDMAERFNFVSTSSHAHLIKMEFWEMKYRLMAFLILAESKLKSWIIKYGRRDSVELLLDG
YVSFIEGYKFFDQYDIIYKALKKAAEVYLNSDTLAEEAEGVGRFLGEATAQWRNLAVEVR
SVRSMLEEVISNWDKYSSTVAALQAWLEDAEQTLNQSEDAKRDFFRNLSHWIQQHMDMND
AGNFLIETCDETVSRDLKQQLLLLNGRWRELFVKVKHYARADEVDKLRTDYQEGINTLKL
FLDVTNQKMTAPVQVSFLNVRTFVQDVEETKHKLPAMEAACKAAWRSAQLLNKDSPEEEV
SHMLALMATVKEQLGKIRERCLPLLRESQSLLPPLEEMEKNITGFYQALEKASRITGSRD
SEGPGDFKLKCQELVTYTHSCKKCLSVIERSHQSLQKTLDGSRTLQHMQTTLLQKRVADL
QSSSQAMIKESAEWRKHVEANSSLMKRFEESRLELEKVLKTAQSCLTERGPPEELLRRHT
EFFGQLDQRVLNSFLKACDELTDILPEPEQQSLQETVRKLHKHWKDVQTEAPFHLLHLKV
EVESSKMMASLQECQVEVTRENRQLASVGSERLVKEHRAFFREKGPQSVCEKRLQAMEEL
CEKLPASDPAHHSLEAARQALADAQEEADNTHQKLMQHQDKWKEYAARYAELSCWLISKE
SQLRLLRSRANDPSKYGQVKATITELRQDAELQEGNLGWLRTRMAALIEVCSDSDGQRHG
GALGKLSVDFKGLIASLSEAEKMVLAVGDCVQFREEVRSTLAEVVEGQKEAQAEAVRILD
SQTVRDAQQLLLQLLKRLKQRRKDVQQLTTRGQQLQAEEGVGDSLQQDLQSLENTLSKME
QSMDSQEQSLEVTLAAWQEFDSQQEAVREFVNKARAASDRDLNFSSPESLGAELSQARVL
LKQCEAEVSHMNTLLKRATEIQLGPRNKALLLGQARALSQQVDQVEAGLKTDVVTLEGMR
VQWEQFGRGFEAFSVWISDKEKQLDPLKSSSAPLEQQISTVTAVSSELREREEVHSRLEA
DSQALGQFLSSGEAARVRARLTQTGRYWEELRESVQQLQARLEESFSHQQRFNASLEEAQ
ASLIGLHTTLEQPITSCSSSSETYKALQSHTDVCQGLEKLKAAVLSLSASARRLSDKEEA
ERAAAALQASYDVSVQQAKDKQSQLEGLLSLWQKYEKDRSSFVSCLERSESLSNPESRRF
STDKTKLISELQDLQGLHSELHSLEACHAGLVALASALGSSAPQQRAQLLTEDLETLHTR
WSAQNTAVPQRTQELQSHLSQVEQFDQALVKFSQWGESMLSTLHSASQINTTHLPPAVTQ
VKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLAAG
LDSGLCKGHLHVGDGQGARTSCRRMADALSAEVDAVRSLLGSKQSEADALGALWTSFRQR
KEQLLKTVEDIEEKADHQSMKEPSLQALQQRLRFFNQLEDELQSHQHEEQWLRDKGQQLA
QRDAEFAGEVLREIGLLKSTWEDTKRLISDRQEQCGVLVELMREYQGLKTSITGIVDSTE
AVVDISSALKDHEETKRSLSKHEGVKTNMSGKQQELDLFSSRGKQLLSELRMIPECDAQV
MKKDVETLVDQWLDVSERVDDNIDRLSKSLAVWEEVRRISDDIESWASSCALELSESLNN
LNDSHKMSGRLAVVEKEIVEKEQRLNTLLENVEELKQHSGGQETPAKLQALEADLQMKIS
NVHKLCEQARGNLKDFSSQRKQLEDYISQMSDWLKSMEESLISTTTGSDPEDIYSVKDLQ
KELLNQQGSIDATRESLNNLCRKYPSEELAGLGSALTDLIKSYEAINQLSARTLVGMQHC
LQQHFNDLVQEFHRWLSEQREIVKECSDRSGDTCVVDRKLQKIKGAMERVEEGEVRLTQV
CEEGEKLLLHLPKASAGQVQQNLSSIQQDWDSFVEQCRQNQQILEDSASLMKGFEGRLKK
LRWWLEHMEKRMTTDLSEAQQQRGPEKAMLEQVEEYQQEVLKERDSFERLCQEAQALNEG
GRGDGSETRVSAQLQSQQQALLRRARERLRSCQLTLQEQQAFQDTLQSTWSWLNGAQERL
ASLDSTVGNKETLEKRLGLVQDILLMKGEGEVKLNMTVGKGEQVLKHNSPEGQEAIRSQL
QRLKDSWANMLMTSMSCHSRLEWTVAQWSCYQESRSQLQQWLETVEQEVSMNLPQQPGLK
EKASLLERLRAVQADVEAHAGVLSRLTEKAVELHEKTADQMFGPEQRAELNVHFADLSAV
VKGKVHSMEGIVSEHEQYLDAVRDFNDWLISAKEELQRWSDLSGDTTSIRRKLSKVQELL
DSKQRGRERLSRVQRSGAAARDHTGSGGFEAVEREEAALLSSWEQWERGALQTRAGLETS
LSQIASSEQEFSVLSSRLGQDLHDFGAQLHDCRLRLAQCEGKHSGEECVKAWQLAKATLA
DLVKAEPTSESLKTQLNDLCRFSRDLGKLSEKVSSLIKEYNSLSLQASRGCQSKEKLLDQ
GFRSAFREFQQWLVNAKINTAKCFDVPQNLSEASSSLQKIQEFLGEREKSQSKVNGVLVS
SELFTSVAAKDRVEGVRAKTNSARDDWKNLMSNLHSRETSLQNLVCQMKDFETSAEPLQG
WLNVTEQAVQESSTRLHDLGAKKQELHKLQSVLEDLASQDVHLSRLREKAQLLWDEHAAG
KGFMHHVSQLSAQYLALTNLTKEKASRIDRIVTEHQMFAQGLKELQNWVTDTSHMLQTYC
APTADKNVLDSRMIKLEALLSARQEKEIQLKMLTTRGESVQRNTSTEGVPVVQKNIQDLK
DSWDALLSASIQCKSQLEGSLSQWTSYQEDVQQFVAWIEQVEESLESGTKPCSEMRDKSA
NLGKAKLLHEEVLSHSALLDTISLKSAKMAEHYVSQLELQDLQERYNAVRENAMMAVGTA
EELVMSHHEYQRALQVFEDWLEEEQEKLSCYTQLEGDVDTLEETLQKLQELQLHCTEGQA
LLNNLLVCRELVTPWGLPQMEERALEMAQQEWRLYQGRLGDTRAQLNSALAKLRQMEQKF
QRLDSWLRGMETKGQLRGHRRSDRTTKDAQLELIKSWQEEVLVYQEEMEGLSILAQQVLD
ETHITSRISTRATQITARYHALLLHLLETIKQLQEEVSCIEDAQGVLGTFSDWLSMSQNS
FSTVASCIDVVDRVAMERKMKKLEALQGDLEQGHNFLKTLREKTDRALDYLEEREAGQLR
EEVDGRLGQLEELTVALRAQHSSLEKCISLSKDFLDKYKAQSHWVTDTQNLLGSAVEPKA
ELYQKKAQLAKYKTVQQTVQSHESAVRSVVEKGEALLETVPDPTVRDNMKRLQADYKDLC
TAAKSQVLSLVEWVKEHEDYNSELQEADKWLLQMSSRLVTSDSMQTSSMEMATQQLARHK
AIMEDIAGFEERLGSLKQKGEGLVASCTEHVQAKISQQVQAQQQGTRDSYSAICNTAQRV
YQSLDRELQKHVSHQDTLQQSQTWLSAVQEELQLHQHQPPSGLQEALKQVKHYRALQEQA
ITYLDLVCSVCDLSDDTVRVTAAEVQRIKLTIEERMSNAQALSEGWREIKEQKQDLSGLF
QDLEQQLLAFSRRPAELETKMADNMLCQVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRLSHTWLELCQQAGTLEGHRQQDLLRSRDYHRCISAMEGLFEQVSVAWDNLART
DAESSSEHLEALRKLAVTLQEQRGTLEELKEQRQKVVQHLNLDDKELVKEQIGHFEQRWA
QLQSLIERKVQDSVVTLEDMALVEARLREARDWAEEQQPALSEAMKMSPPPELAQSFLFD
HLSVCSELEAKQLLLAQAMADADRILAHLGLDERQRLQQLIADTQSQVESLGVTVAQRRK
HLSKAFTERTQFLMAVGQSITWVQQNEKKAQAEESVALLPDDLAKQVRTCRNIQSSLKAY
QSELTSLWAQGRDLMRDASEEEKNEILTKLQELQNIFDKTLHRCGQRLQELEKALTSRKY
FKTDLEKTCQWLKQADIVTFPEINLMNGDQELEFQMLKYQQIIEHAVEYENLLLTVQRAG
QEILPTLNEVDHCYLDEKLNTLPQQYNTILALAREKQEKIQQAILARKEYASFIDITHKA
LKELEEQFNDLEKQPVGLQTEEVISLQGDYKAILVDLGDLGQAVGELNQKKEGFRSTGQP
WRPEEMTQLVSLYNGLKRLVEQRVEHLDDTLESFEDHKAMAMQVDSELKATKEQLVKVNT
ETQSAEERLKNYHALAGSLQSASSHLSRLMEQMDTLATHVDHAAQDASKEQVVLWQDELH
SLQAAVGDLIEECEDRFVQSKDFETEMTRTLDWLQQVRDELGCAVIVDVRLEKVQEEIRK
QQIMQEEVQSRLRIVAALSSREKQKYVSANELVPAHMDTSLEEMAKLQAEVQKALSSKQI
TLEQALLLCQRYHFRMQSACEWLEEAVSFLQQASLGVDVENYEECLRQQEDILSTEQEFL
LHLEELGQLPGQLERLVTPSAREQLRLSVGSAQQRGVEVRDQLQCHQDVLHSCVAQWKAY
QESRQTVIELMNEAEKKLTEFCTAKAGTSQEAEDKLCSHRSLVSLVSGFQEKLSGLEEQA
AQLELVGSDASKATISRSMTTVWQRWTRLRSVARGQERVLEDTAQEWRTFREKMGKLRDV
SEELRARVPDSAVEKASKAALQGLQEQHDLLSQDVERELSGLTLLRQYALSLLHVVEVPS
PTTEQEELPSLKEIRAVQDQLESLLAQSRARRAQASEELREREELEKDLSVIKAWIQETR
ELLHNPTPDIDALLQNLEVVHGDVITYRQNVEKVAEQQQTKYLDLYTILPSEISMQLAEV
SLALGAIEDQVLSREREIQKTRDIKEDFSSKIHDVSEKLKAISAKFKEKSPDVDHAKDEV
KSLAEDLDSCGRSLSELEAAIQEFGRRNPLLAKQLSDTTSKLSEIHHHTSRLADARNNWL
KKAVCYLDEYNEMLDFILRWSERARSLVRANIIWNSSVHLQEAVLRESRELHGDLESMAE
KVELLSEVLQVEALTQQVCELSRHAEELQQSIKTRLQSLQDADKSMEALEYEVRALHGAL
EQVQTTLTSPELARQSLKEQLIQRQRLLADMESFKQLVQAVQMCQSALRVPEEVMPNLAI
CRTALRLQQEASQLQHVAIQQCNILQESVVQYEQYEQEVRELQGLIEEAHGVIQDRPFST
NSIQELQAQIIHHEELAQKIKGYQEQIASLNSKCKMVSVKAKHATMLLTVTDVEGLPVGL
DHLDEDRAQNQVTAGRCHTLLSPVTEESGEDGVTSELSSPPTNSSPPSLAAHSQNAASRA
GRGTLTRAPVQQLYDPTFDTVANLDDLQRSWETLKNVISEKQKSLYEALEKQQRYQGSLQ
SISAKMESLETQLSQALPGDRSPTSLMEAHQELTLEVQALQGEIDGLQASFSEDLSGDTA
GVGDTADQLAMQSSLAVLAQRMATIHMKASGKQQLLEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMLLEIEEKVLALAELSLQSRSLL
QEEGEETKEEAERLAGKLVTLKDSLEELQGMLLERQGSIQGCLLEQESSGSDSSPSYSPS
SQDWLAQAHTTRCQQRQDSLQRQKELEEQLSEQKKLLQSVASRGEEILIQQASPSSARPF
SAEALAEREAQAAEQSRQRWESLRLELRTKLQLLHKTLEQEHQQPVYSRTSGVTPPGSLY
TDQAQPHDTTSIRCLFDGFRQTMEDADTQPGGLQRGGSQAEQQLYAAVSSSSSWLDHVEN
TLFSGSVLLTENPETLLQKQETLESEVRAVAEEVRHSQTLLPGPPGPCRAGRTLVGDTLD
CLRERLAALGSALSLRCDHMRTRMHQLTANQTELQLLQTALIETKCQILQTLAGAMDKPA
SQQLEVIGDAEDNLRDFEQQITELKSRGAALQADQPSTNKLLKLQDSYEELVMTVGSRRS
GLNQNMALNEQYERALQDLTDLVDTAQDKMAADQRIVASSVDEVQNLLEKHKEFFQGLES
HMILTETYFRKISGLVLPKESQALEATLGQAQAVLREAHSRGVELEGVRETWCRLVQDYQ
CLYRHLEAVEGSIPTVGLVEETEERLNERISLYQGLKGRLTEQQHKLYQMLDEGKRLLLQ
VSCPVLENQLALLGEHWLGHTTRVSRELQRLDAVLKHWTRYQREWTELVGWLQSALERLD
FWNTQAVLVPQELESVRDHLGAFLEFSKEVEGRASLKSSVVVEGNQLLRLKKVDTAALRS
DLARVDAQWAELLTRIPVVQEKLHQIQMEKLASRHAISELVNWMSLMESVIEEDEENFKS
AVGFTVVQDYLQKYKGFRVDVSCKQLTVDFVNQSMLQSGGQDAESKRSDKTDFAERLGAM
NRRWQILQGRITERIQFLESLLEMWQEYESSVQSLKSWMLSQEERLKRKHRIEDLTSVQN
ALKDCQEMEELLKEKERDLERVEEQGCALVQNKTDEACAIVMETLQGVNHTWANLDHLIG
QLKISLRSVLDQWSAYKRASEEINGHLMEGRYSVSRFRLLTGSLEAVELQAQSLQNLQGE
LEKQESSVRRFGAATHQLLRECHPSVSESLNLALKDVNSRWTGLLEEISERQRSSKALLQ
LWQRHKELQEQSAASVLRQEERAEQLLKAACSKDMADHEVSDWSHECSELLRSQAPVQAC
LQVLQELGVQLKQQVDTSAAAAVQTDHLSLCQRLAAVEQALSRQLTALQTGVQDYEKFNS
QLDALARWISEPEDVLRAQDPNGSSDLCLIQDRMEQLKRMMLKFSSMAPELERVNELGYR
LPLNDTEIKRMQNLNRSWASSSSQTTERFSKLQSFLLQQQTFLEKCETWMEFLVQTEESL
AVEISGNYPSLVEQQKAHELFQAEMFSRQQILHSIISDGQRMLEQGQVDDRDEFNLKLAL
LSNQWQGVVRRAQQRRGIIDGLIRQWQRYRDMAEKLRRWLLEMAPPRQPAVPGTTVPLQQ
ARALLDATLLKEKVLQRQQGSYILTVEAGRQLLLSADSRAEGALQEELSLIQDGWRHANA
SLDAHKRELSTLLKDWERCERGIGGSLEKLRAFKRQLSQPLPDLHEDLQGEQMRCKELES
RFAGWTDDLAHLSLLRESLSCYIGPEDLSVLQERIELLQRQWEEICHQLSLRRQQVSEKL
NEWWVFGEKYKELCEWLTAMESKVSHNGDVSIEEMIDKLRKDYQEEITLVENNKLQLHLL
GERLARASHQSKACEIEGKLGKVDDRWQHLLDLIGARGKKLRETLVAVQQLDKNMSSLRA
WLAHIETELSRPMAYDTCDFQEIQRKLDLQQELQRDIEKHSTGVASVLNLCEVLLHDCDA
CATDTECDSIQQATRSLDRRWRAICALSMDRRLKIEETWRLWQKFLDDFSRFEEWLATSE
RTAASANSSGVLYTVAKEELKTFEGFQRQVHESLTHLEFLNKQYRRLARENRTDAAGRLR
EMAHDANQRWDDLQKRVTSVLRRLKHFIGQREEFETARDGILVWLTEMDLQLTNIEHFSE
CDIQAKIKQLRAFQQEVSLTSPKIEVIYRQAEALMEKSEPLDATVIEEEQEELRRYCQEV
FGRVERYHKKLLRLPLTDEDTEVSYSDRELDLDEGLSSMPWGEPEGSHSPLPSSSRSASL
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKHVVLLHQLDSSRSRTPTSLELDGSYMGYMRLLGECRGSIDQVKRMGSELKEEEDGASG
LADPSSSESQSSGVIERWELLQAQDLSKEMRTKQNQQKWQQLTSDLRSVWAWLGQAGEEL
EQQRRLELSTDIQTIRLRIKKLKELQKALDKRKAIVLSVNLCSAEFVQCDSEESREMQAR
LTDMNNHWDKLGRALEAWRASLQDALMQCQDFHETSHGLLLWLENIDRRRNEVVPIDPLQ
DSETLTQHHKTLTQMRRELLDSQVKVALLQDMSLQLLVNAPGSDCLEAKEKVHVIGNRLK
MLLKEVTRDLRELARTLDLTSSQQDLSSWSSADDLDTSGSVSPASGRSTPSRRRSQRGHS
SVSRTGAPVARSHLSRSHDAGSVSSRSEAGAGSSSLRRALWVALPIQLFLLLLLVAVAYL
LVPMTDEDYTCSQCNNFASSFYPMLSYTNGPPPVW
Download sequence
Identical sequences ENSGMOP00000020964 ENSGMOP00000020964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]