SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000020967 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000020967
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.46e-48
Family Calponin-homology domain, CH-domain 0.000000453
Further Details:      
 
Domain Number 2 Region: 196-255
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-20
Family EB1 dimerisation domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000020967   Gene: ENSGMOG00000019491   Transcript: ENSGMOT00000021479
Sequence length 273
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2306:123698:128049:1 gene:ENSGMOG00000019491 transcript:ENSGMOT00000021479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMAVNVYATSVSIDNLSRHDMLAWVNDSLLLTYTKIEQLCSGAAYCQFMDMLFPGCVLLK
KVKFQAKLEHEFIHNFKVLQATFKRMSVDKIIPVEKLVKGKFQDNFEFVQWFKKFFDANY
DGKEYDPLQARQGQEISAPPNPGDHFTYRPKRTPGPQRTSPTIPKNVPTLQRVQHTAPPM
RKNPSLSRNGASDAEMLELNQQLMELKLTVDGLEKERDFYFSKLRDIELICQENESENHS
VKIIDILYATEDGFAPPEDEELDPQAHLDQDEY
Download sequence
Identical sequences ENSGMOP00000020967 ENSGMOP00000020967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]