SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021020 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021020
Domain Number 1 Region: 11-179
Classification Level Classification E-value
Superfamily EF-hand 2.36e-27
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 2 Region: 184-258
Classification Level Classification E-value
Superfamily EF-hand 0.000000000482
Family Polcalcin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021020   Gene: ENSGMOG00000019544   Transcript: ENSGMOT00000021533
Sequence length 270
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4120:7021:21537:-1 gene:ENSGMOG00000019544 transcript:ENSGMOT00000021533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKAQPPHLHLAECTASQFLDIWKHFDADGNGFIEGKELESFFKELEEARKGAGVDPAN
PTFRERMKEFMQNFDKNKDGRIEMSELAQILPTEENFLLCFRQFVGSSAEFMAAWRRYDT
DRSGYIEANELQGFLSDLLKKANRHYDDQKLQEYTQTILKMFDLNGDGKLGLSEMARLLP
VQENFLLKFQGVKLTTEQFNAIFTYYDKDGNGYIDEQELEALLRDLYQKNNKEVNAEHLQ
GYKQSIMALSDGGKLYRSELEIVLCREPMV
Download sequence
Identical sequences ENSGMOP00000021020 ENSGMOP00000021020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]