SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021048 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021048
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-46
Family Calponin-homology domain, CH-domain 0.0000008
Further Details:      
 
Domain Number 2 Region: 133-177
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000196
Family EB1 dimerisation domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021048   Gene: ENSGMOG00000019570   Transcript: ENSGMOT00000021562
Sequence length 177
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1609:230143:231556:-1 gene:ENSGMOG00000019570 transcript:ENSGMOT00000021562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVFSTSLNNDNMSRHELLSWVNVSLQMNYSKIEHLCSGAAYCQFMDVLFAGCLPLKR
VKFNAKLEHEYLQNFKILQNSFKKAGVDKIIPVDRLIKGKFQENFEFVQWFKKFFEANYD
QRDYDPVAARHGQETEKELNFYLGKLRTIELICQDRETEGGADPTLQRILEILYATD
Download sequence
Identical sequences ENSGMOP00000021048 ENSGMOP00000021048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]