SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021070 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021070
Domain Number 1 Region: 4-147
Classification Level Classification E-value
Superfamily EF-hand 1.21e-38
Family Calmodulin-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021070   Gene: ENSGMOG00000019592   Transcript: ENSGMOT00000021584
Sequence length 149
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3631:136866:139026:-1 gene:ENSGMOG00000019592 transcript:ENSGMOT00000021584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRELRPEEIEELREAFVEFDRNKKGYISCGDLGECMRTMGYMPTEMELIELSQQICGGKV
DFEDFVELMGPKMLAETADMIGIKELRDAFKEFDTNGDGQINIMELREAMKKLMGEQLTN
REIDEILRDVDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences ENSGMOP00000021070 ENSGMOP00000021070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]