SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021165 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021165
Domain Number 1 Region: 30-526
Classification Level Classification E-value
Superfamily Sema domain 1.02e-171
Family Sema domain 0.0000000000816
Further Details:      
 
Domain Number 2 Region: 522-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000075
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 589-670
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000982
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021165   Gene: ENSGMOG00000019678   Transcript: ENSGMOT00000021683
Sequence length 707
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1609:685457:694221:1 gene:ENSGMOG00000019678 transcript:ENSGMOT00000021683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAVTMTTSGARLLLVALCVYSGQGLQQSAPRVRLSFKELLDTRAARPFSFAFNTSDYRIL
LMDQDQGRLYLGSREYLVALDMQNVNKEPLIIHWPASAKRKGECQMTGKGRQGECANFVR
LIEPWNRTHLYTCGTGAYQPICTFINRGWRAEDYLFRLVPGYADSGKGKCSYDPNQENIA
VLIDGNLYAGVHIDFMSTDAALFRTMGGRTAIRTEQYDSRWLNEPVFLKIQQIPDSAERN
DNKLYFFFREKSLDSVSGASPSVLARVGRVCLNDEGGQKSLVNRWTTFLKARLICSVLGE
DGVETAFDELRDVFIQPTQDEKNPVVYALFTTAGSVFKGSAVCVYSMADIRNVFNGPFAH
KHGHNYQWTEYTGKIPYPRPGTCPGGTFTPGIDSSKDFSDEAVNFMRAHPLMFNAVYPIH
RRPLVVRSGVDYRYTAMVVDQVDAVDGRYEVLFLGTVTLTDHGTVQKVIVLPKDPTNLEE
LTLEEVEVFRNKAAVKTMKISSKRQQLYVSSDAGLTQVSLHRCGVYGRACSDCCLARDPY
CAWDGETCSAFTPSTKRRSRRQDVKHGDPLRQCRGFNAKDVENRQKEMVQFGVEGSSTFL
ECEPRSPQASVKWLFLREGRRKVLSRAGGVLKTNNGILLKALNQSDAGQYHCLATENNFK
HTVTRIALRILDRDIVLALTSRDPDKEPHAPKARPRRPPARTPPPPP
Download sequence
Identical sequences ENSGMOP00000021165 ENSGMOP00000021165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]