SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021252 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021252
Domain Number 1 Region: 12-159
Classification Level Classification E-value
Superfamily EF-hand 1.68e-33
Family Calmodulin-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021252   Gene: ENSGMOG00000019765   Transcript: ENSGMOT00000021770
Sequence length 161
Comment pep:novel contig::contig118094:50:535:1 gene:ENSGMOG00000019765 transcript:ENSGMOT00000021770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CELDLKSVVVEFSADQIEEFRDAFTLFDETPAGEMKIRYAQCGDVMRALGHNPTNSEVLK
LLGKPKAEEMNAKLLDFDTFLPMLQHISRTKEQGTFEDFVEGLRVFDKEGNGTVMGAELR
HVLATLGEKLSEDEVDRLMLGQEDSNGHINYTEFVKHVMAG
Download sequence
Identical sequences ENSGMOP00000021252 ENSGMOP00000021252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]