SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021263 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021263
Domain Number 1 Region: 15-112
Classification Level Classification E-value
Superfamily Immunoglobulin 5.68e-16
Family V set domains (antibody variable domain-like) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021263   Gene: ENSGMOG00000019776   Transcript: ENSGMOT00000021781
Sequence length 114
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3455:87452:87793:1 gene:ENSGMOG00000019776 transcript:ENSGMOT00000021781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVSSCLSPGVSLGIEVHQTPSELIRKPGDSAELVCRHGETNYRVMLWYQQSAGQRNLSLI
GHLNYQTSNIESAFKQDFSISGDLSGETTKNASLLVHLKDPESSGVYYCAARLA
Download sequence
Identical sequences ENSGMOP00000021263 ENSGMOP00000021263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]