SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021600 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000021600
Domain Number - Region: 78-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0016
Family RecA protein-like (ATPase-domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021600   Gene: ENSGMOG00000020113   Transcript: ENSGMOT00000022118
Sequence length 245
Comment pep:novel scaffold:gadMor1:scaffold00824:14087:14821:1 gene:ENSGMOG00000020113 transcript:ENSGMOT00000022118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQHKIKSRLMKKFRCVFEGIAKAGQPTGLNDFYTEIFITERDSGEVNKEHEVRLIETASR
KPVKEETTIRCEDIFKPFHGQDKPIRTIMTTGVAGIGKTVLTHKFTLDWAEGKANHDIHF
TFLLTFRELNLLKEKEFSLVELLHHFFNETIEAGIYRYDWFQVVFILDGLDECRLPLDFQ
RNPIWTDVTRSTSVDVLLTNLIRGDLLPSARIWITTRPAAANQVPAECVDMVTEVRGFTN
PQKEV
Download sequence
Identical sequences ENSGMOP00000021600 ENSGMOP00000021600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]