SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021688 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021688
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 3.14e-48
Family Nucleosome core histones 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021688   Gene: ENSGMOG00000020201   Transcript: ENSGMOT00000022206
Sequence length 127
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4122:14598:14978:1 gene:ENSGMOG00000020201 transcript:ENSGMOT00000022206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKPAKK
Download sequence
Identical sequences ENSGMOP00000021200 ENSGMOP00000021659 ENSGMOP00000021688 ENSGMOP00000021690 ENSGMOP00000021200 ENSGMOP00000021659 ENSGMOP00000021688 ENSGMOP00000021690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]