SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021826 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000021826
Domain Number - Region: 82-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000678
Family G proteins 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021826   Gene: ENSGMOG00000020340   Transcript: ENSGMOT00000022344
Sequence length 244
Comment pep:novel scaffold:gadMor1:scaffold09053:29024:29755:1 gene:ENSGMOG00000020340 transcript:ENSGMOT00000022344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQHNIKSYLKKKFTCMFEGIPKAGEQTPLNDFYRELFITQRGSGEVNKEHEVRLIETASR
KPAKEETSIKCEDIFKPLPGQYQHIRTIMTTGVAGIGKTVLTNKFTLDWAEGKTNHNIHF
TFLLTFRELNLLKKEFSLVELLHHFFSETKEAGICRYDQFQVVFILDGLDECRLPLDFLN
NPIWTDVTEPTSVDVLLTNLIKGYLLHSARIWITTRPAAANQIPAECVDRVTEVRGFTDP
QKEE
Download sequence
Identical sequences ENSGMOP00000021826 ENSGMOP00000021826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]