SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021896 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021896
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Histone-fold 7.74e-39
Family Nucleosome core histones 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021896   Gene: ENSGMOG00000020409   Transcript: ENSGMOT00000022414
Sequence length 69
Comment pep:novel contig::contig740479:421:630:-1 gene:ENSGMOG00000020409 transcript:ENSGMOT00000022414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTK
AVTKYTSSK
Download sequence
Identical sequences ENSGMOP00000021896 ENSGMOP00000021896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]