SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021913 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021913
Domain Number 1 Region: 36-384
Classification Level Classification E-value
Superfamily L domain-like 7.94e-57
Family Ngr ectodomain-like 0.0094
Further Details:      
 
Domain Number 2 Region: 418-508
Classification Level Classification E-value
Superfamily Immunoglobulin 2.33e-18
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021913   Gene: ENSGMOG00000020426   Transcript: ENSGMOT00000022431
Sequence length 610
Comment pep:novel genescaffold:gadMor1:GeneScaffold_417:4210:6039:-1 gene:ENSGMOG00000020426 transcript:ENSGMOT00000022431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQEGSKMFVELVVRWGAWSLILLLQSGGVAVFARGCPARCVCRPDPSEVNCSGKYLTSAP
EGCSSDARRLDLSSNKIKTLGRRQFFGLQQLQELNLNDNVISMIEVEAFQGLHNLRTLHV
KNNRLKIIPVGVFSGLTNLRFLDLSENEILVFLDYTFRETVNLQFLEAGENDLVFISQRA
FVGLQNLQELNVDRSNMTSIPTEALSQLQSLTHLRMLRLSISMLTNNAFRRLHRLRSLQI
SHWPALDTLASNSLIGLNLTSLVISNCNLSAVPYAALRHLVYLRFLDLSYNPITAIQGNL
LGDLLRLQELHLAGGSLLRIEPGAFRGLAYFRMLNVTSNQLSTLEESAFHSVGNLQVLRL
DANPLACDCRLLWVVRRRLRLNFDGRQPTCVSPEAVRQREFRDFSEKELPRMFTCRPARI
ADRRPQESRVEEGTTVLFSCRADGDPAPAITWISPSKAVLSSTGRLRVLSNGSLEVRFAQ
VQDSGAYRCVAGNAAGNETLSVNLQVKGFSRNRTLTFYSEEAPYSQAATTNSSAQIAKPY
PFDAKTLVIATTMGFLSFLSSVAICFVFMFFWSQSKGQIKHTATIDFVPRSSMGGGGDGA
DAGRFTMKLI
Download sequence
Identical sequences ENSGMOP00000021913 ENSGMOP00000021913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]