SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021924 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021924
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-48
Family Nucleosome core histones 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021924   Gene: ENSGMOG00000020437   Transcript: ENSGMOT00000022442
Sequence length 126
Comment pep:novel genescaffold:gadMor1:GeneScaffold_577:54778:55155:1 gene:ENSGMOG00000020437 transcript:ENSGMOT00000022442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT
EKPAKK
Download sequence
Identical sequences ENSGMOP00000021924 ENSGMOP00000021924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]