SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000021957 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000021957
Domain Number 1 Region: 54-201
Classification Level Classification E-value
Superfamily EF-hand 6.58e-34
Family Calmodulin-like 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000021957   Gene: ENSGMOG00000020470   Transcript: ENSGMOT00000022475
Sequence length 203
Comment pep:novel genescaffold:gadMor1:GeneScaffold_56:224843:225454:1 gene:ENSGMOG00000020470 transcript:ENSGMOT00000022475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKAEPKKFEPKKPEPKAAAAPPAPKAAPAPEPEPEPPKEPDFDPKSITLEFSGDQIE
EFKEAFTLFDRTPKGEMKITYAQCGDVMRALGQNPTNADVLKVLGKPRPEEMSSKLVDFE
TFLPMLQHISRSKDQGNFEDFVEGLRVFDKEGNGTIMGAELRHVLATLGERMTEDEVDRL
MAGQEDANGCINYASFVKHILSG
Download sequence
Identical sequences ENSGMOP00000021957 ENSGMOP00000021957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]