SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000022055 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000022055
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-52
Family G proteins 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000022055   Gene: ENSGMOG00000020568   Transcript: ENSGMOT00000022573
Sequence length 182
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3660:40659:41207:1 gene:ENSGMOG00000020568 transcript:ENSGMOT00000022573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDL
EGEREVSSGEGKALAQEWNCPFMETSAKNKGSVDELFAEIVRQMNYSTVPSGSDQCCSCV
LL
Download sequence
Identical sequences ENSGMOP00000022055 ENSGMOP00000022055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]