SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000272 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000272
Domain Number 1 Region: 350-496
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.03e-53
Family Calpain large subunit, middle domain (domain III) 0.000000517
Further Details:      
 
Domain Number 2 Region: 180-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-43
Family Calpain large subunit, catalytic domain (domain II) 0.00000121
Further Details:      
 
Domain Number 3 Region: 514-677
Classification Level Classification E-value
Superfamily EF-hand 1.12e-41
Family Penta-EF-hand proteins 0.00000571
Further Details:      
 
Domain Number 4 Region: 7-134
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-20
Family Calpain large subunit, catalytic domain (domain II) 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000272   Gene: ENSGMOG00000000264   Transcript: ENSGMOT00000000281
Sequence length 679
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4166:119061:131851:1 gene:ENSGMOG00000000264 transcript:ENSGMOT00000000281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKRDLKSGIGTISKAVRYLGQDYDTLREEWLGYGRLFEDETFPATYSALGFKDLGPSSPK
VRGVTWMRPTXXXXXXXXXXXXXXXXXXXXXXXXDCWLLAAIASLTLNKEVLARVVPHGQ
SFEDGEYAGIFHFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
NGCYEALSGGSTTEGFEDFTGGIAEVHELLKPSPNLFHIIQKALRRGSLMGCSIDITSSS
DSEAVTSQKLVKGHAYSLTGAEQVEYRGDMEKLVRIRNPWGQVEWTGNWSDXXXXXXXXX
XXXXXXXXXXXXXXXXXXXMSFTDFLRHYSRLEICNLTPDALSDDSITKWALSMYNGNWR
RGSTAGGCRNYPHTFWTNPQFVIKLDEEDDDPEDGEEGCSMVVGLIQKNRRKLRKVGEDM
HTMGFAIYEFSGQRNIHLNKNFFLRHAAAARSETFVNLREVCTRFLMPPGEYLILPSTFE
PNQNGDFCVRVFSEKQELDDPVECNVKQVDIDEDDVGERFRSLFGQLAGEDSEISAFELK
KILNRVVTQRSDIKTSGFSLDTCRNMVNLLDKDGSGRLGLVEFKILWTKIENLLNIYREK
DVDKSGCMSSTEMRMAVEEAGFRLDNSLNQILVARYSDSDLTVDFDNFVSCLVRLESMFK
TFNAIDNDGSGTVELNLIE
Download sequence
Identical sequences ENSGMOP00000000272 ENSGMOP00000000272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]