SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000391 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000391
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.14e-23
Family Hormone receptor domain 0.00029
Further Details:      
 
Domain Number 2 Region: 112-387
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000128
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000391   Gene: ENSGMOG00000000393   Transcript: ENSGMOT00000000413
Sequence length 419
Comment pep:novel genescaffold:gadMor1:GeneScaffold_45:16902:85199:1 gene:ENSGMOG00000000393 transcript:ENSGMOT00000000413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCEVETEIEQEKERCHNSTSGNSTSGCQGMWDVVACWPPSPVGEVVTITCPHYFSYFSDQ
HKGNLSKTCTADGWSEMLPIDIAVNCGYNHNISGDEGRFFWQVKVGYTIGHSVSLASLLT
AVLILCIFRKLHCTRNYIHLHLFVSFILKAVSVFVKDVVLYEVGEEDNCSSGSLGCKVAM
VFFQYGVMASFFWLLVEGLYLHALLAVSFFSERKYFWAYILIGWGGPMVFITAWTIAKAK
YNDVGCWDIIENSDGFWWIIKTPILVSILMNFFLFICIIRILRQKINCPDIGRNESNQYL
RLAKSTLLLIPLFGINFIVFAFIPEQLKTEMRLVFDLILGSFQGFVVAVLYCFLNGEVQA
EVKRKWRRWLLQRYMGSDSTKYQQPSSNGNTFSTQISMLTKCSPVTRRVSSSGPEDSSV
Download sequence
Identical sequences ENSGMOP00000000391 ENSGMOP00000000391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]