SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000720 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000720
Domain Number 1 Region: 174-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000176
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 230-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 3 Region: 293-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000720
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000893
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.049
Further Details:      
 
Domain Number - Region: 62-146
Classification Level Classification E-value
Superfamily Sialidases 0.00775
Family Sialidases (neuraminidases) 0.049
Further Details:      
 
Domain Number - Region: 356-384
Classification Level Classification E-value
Superfamily TIMP-like 0.0942
Family Tissue inhibitor of metalloproteinases, TIMP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000720   Gene: ENSGMOG00000000723   Transcript: ENSGMOT00000000751
Sequence length 384
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1634:5:33391:1 gene:ENSGMOG00000000723 transcript:ENSGMOT00000000751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAADPRRARPASHLTDLNSAHNLTCWQSENLSASPHNVTLALSLGKKFEITYVSLQFCSP
RPESLAIYKSMDYGKTWTPYQFYSSQCRRMYNRPGRAAITKQNEQEALCTDGHTDPHPPS
GGLIAFSTLDGRPSGKDFDNSPVLQDWVTVTDIRVVLMPPYFYAAGDFQVGGRCKCNGHA
SRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCR
FNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMARPVTHRRACKACDCHPVGA
AGKTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPVAPCIKIPVVNPTALISSTEEPAD
CESYCKPVKGNLKINMKKYCKKDY
Download sequence
Identical sequences ENSGMOP00000000720 ENSGMOP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]