SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000762 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000762
Domain Number 1 Region: 254-342
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000000447
Family PA3566-like 0.07
Further Details:      
 
Domain Number 2 Region: 27-81
Classification Level Classification E-value
Superfamily EF-hand 0.000000307
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000762   Gene: ENSGMOG00000000759   Transcript: ENSGMOT00000000794
Sequence length 348
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1301:185460:217776:1 gene:ENSGMOG00000000759 transcript:ENSGMOT00000000794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLACTEMITMCLQSAKRKHLLAQQQPLQITGQGLPIFHDIFRRADKNDDGKLTFEEFNTY
FADSILTTEELQELFCSIDGRQNXXXXXXXXXXYFAQHLGGYVNVLSALESLNIAILKAM
DKTKEEYQGASVLGQFVTRFMLRETSSQLLSLQRSLQYAMEAVEEQSCPQPXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEDGEENWCSQISRLQQLLDKLECQSPKL
EPLKEDSLAGTYKSNLLLVQRQVTVAEEDLEDFQKVLKSYSDATAAHSDNLHMSVQKLPE
KSCYIMYEFWQDRISWMSYLQSNSSKDFQRCVIQMLVGPEVVATMLVP
Download sequence
Identical sequences ENSGMOP00000000762 ENSGMOP00000000762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]