SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000764 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000764
Domain Number 1 Region: 12-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.44e-77
Family BAR domain 0.0000000189
Further Details:      
 
Domain Number 2 Region: 276-359
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000764   Gene: ENSGMOG00000000764   Transcript: ENSGMOT00000000796
Sequence length 364
Comment pep:novel genescaffold:gadMor1:GeneScaffold_534:19782:33888:-1 gene:ENSGMOG00000000764 transcript:ENSGMOT00000000796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGFKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTSKAVVEVISKTSEYLQP
NPASRAKLSMLNTMSKIRGQVKNPGYPQAEGLLGECMVKYGRELGEDTNFGGALVDVGDS
MRRMAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQGKIPD
LEIRQALEKFHESKDVAETSMYNLLETDVEQVSQLSSLVESQLQYHRQAVTVLDELSDKL
RERMNEAQSRPRREYTPKPKPVYDYEDNDQSNGDYSTVVPPPARNSXXXXXXXXXXXXXX
XPEQPSCKALYDFDPENEGELGFREGDIITLTNQIDENWYEGMLHGQSGFFPLNYVEVLV
ALPL
Download sequence
Identical sequences ENSGMOP00000000764 ENSGMOP00000000764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]