SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001589 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001589
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.05e-16
Family Hormone receptor domain 0.0008
Further Details:      
 
Domain Number 2 Region: 70-297
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000275
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001589   Gene: ENSGMOG00000001519   Transcript: ENSGMOT00000001645
Sequence length 316
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2080:48:49573:-1 gene:ENSGMOG00000001519 transcript:ENSGMOT00000001645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CETQWDEVRCWFNVDEGQVVNVSCSDIFQHFSAGQGYVSRSCTAEGWMDLSPPYEEACLF
SHDEGPESETIFLSTFRKVYTVGYATSLVSLITAVGVFTVFRKFHCTRNYIHMNLFCSFI
LRASAVFIKDAVLFADETLDHCSMSTATCKAAVAFFQFSILANYFWLLVEGLYLQTLLAL
SFVPQRKYFWGYILIGWGLPSIVLIIWVLTRYLYDDRSCWDDTDHVGIWWIIKGPITLSL
LVNIVIFISVIRTVVYKLKRPAIGGSQDTGHFMRLAKSTLFLIPLFGMHYTVFAFLPEGT
CLAARLYLELGLGSFQ
Download sequence
Identical sequences ENSGMOP00000001589 ENSGMOP00000001589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]