SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001694 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001694
Domain Number 1 Region: 160-357
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.43e-56
Family Prokaryotic proteases 0.000000708
Further Details:      
 
Domain Number 2 Region: 372-468
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-18
Family HtrA-like serine proteases 0.0012
Further Details:      
 
Domain Number 3 Region: 24-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 101-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000112
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001694   Gene: ENSGMOG00000001611   Transcript: ENSGMOT00000001753
Sequence length 471
Comment pep:novel genescaffold:gadMor1:GeneScaffold_125:61267:153556:-1 gene:ENSGMOG00000001611 transcript:ENSGMOT00000001753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWPLLCVSRSTSPAVAQLSNRYVIGCPTRCDKSSCPRLPSNCLAGESLDACSCCSVCAS
GEGETCGGGARPECGEGLECSVAGGAGSSVTVRRRSKSGVCMCKAVDPVCGSDGVSYRNI
CELKRVSSRAQKLKQPPVIFIQRGACGKVQQNPDSLRFKFNFIADVVEKIAPAVVHIELY
RKMVFSKREVAVASGSGFIVSEDGLIVTNAHVVANKHRVKVELKSGASYDATIKDVDEKA
DIALIQINTPIQLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGL
RDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRQFLAESHD
RQAKGQTSQRKKYIGVRMITLTLMLAKELKDRQSDFPDVTSGAYVIEVISRTPAETAGLQ
ESDVIISINDGRITSANDVSAAIRRDGKLRTVVRRGNEDVILNIVPEEIDP
Download sequence
Identical sequences ENSGMOP00000001694 ENSGMOP00000001694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]