SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001825 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001825
Domain Number 1 Region: 174-240
Classification Level Classification E-value
Superfamily Homeodomain-like 8.55e-21
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.4e-16
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000196
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001825   Gene: ENSGMOG00000001730   Transcript: ENSGMOT00000001886
Sequence length 418
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4291:28830:33514:1 gene:ENSGMOG00000001730 transcript:ENSGMOT00000001886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCDKPILDRFLLKVLDRTWHVKCVTCCECKSNLTEKCFSRDGRLYCKTDFFRRFG
TKCGGCSEGISPSDLVRRAQSKVFHLGCFTCVMCNKQLSTGEELYVLDELKFICKEDYQN
SQGRDTVLLSVTTCSDPSLSPDPQDPLADDGKESEGGPLSDKEGANNENEEASVAGKRRG
PRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLS
ALGARRHAFFRSPRRMRSLGERMEPGELLAGGPFSYYADYPGEYYGSGGNYEYYQGPPSS
QAQTPADLGYVPSSVPTGTPLGGMDPQHHHHHQHPHHQHQHPGHQDVPCYSDIMSASHHH
HAADSPSPEPNGPGSMRSVSSDMCGSSGTPFTVLSLSENGYTNQLSQPSSEVSEGTVW
Download sequence
Identical sequences ENSGMOP00000001825 ENSGMOP00000001825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]