SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002197 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002197
Domain Number 1 Region: 351-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-55
Family SPRY domain 0.0000281
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 4.37e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 135-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.43e-16
Family B-box zinc-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002197   Gene: ENSGMOG00000002064   Transcript: ENSGMOT00000002267
Sequence length 529
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3093:75800:80530:-1 gene:ENSGMOG00000002064 transcript:ENSGMOT00000002267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASANTSWSEENFSCSICLDVFNNPVTTACGHNFCRTCITKFWDEQVKYKCPVCVKVFDT
KPDLQVNLLLSDMASQFRTSVRVKDSLGEPADVPCDFCTGTQLKAVKSCLVCLISYCQTH
LEPHQRVAGLKKHRLVEPMDRLEDRMCKIHNQLLELFCKTDQVCVCQSCTETDHKSHPVV
PLKEEYEVKTAQLGKIEADVPQMIQERKLRIKKLKDTVEMSKKVADRELADGVQVHTALI
GCVEKCRDEFNQTVIERLKSTVKRAEDLIKELEQEIGDLTKISSEVMPLSQTTDHLCFLR
AFRSLKDPPPTRDWTTVEVIPPSYVGTLRRSLDQLEETLNMEMEKMRDGELKRVQQYEVD
VTLDPDTAHPRLILSEDGKQVHHGDEEKELPDNPKRFTEYTYVLTRQSFSSGRFYFEVQV
KDNNNWCLGVARESINRKGKITVKPVKSYWILYTTIKGFVNPSVRLPLRAKLQKVGVFVD
YDEGLVSFYDVKARVHIYSATGCSFTEPLYPFLGGHSASLIISPVNQTD
Download sequence
Identical sequences ENSGMOP00000002197 ENSGMOP00000002197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]