SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002359 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002359
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.49e-17
Family Hormone receptor domain 0.00057
Further Details:      
 
Domain Number 2 Region: 74-355
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000000119
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002359   Gene: ENSGMOG00000002209   Transcript: ENSGMOT00000002438
Sequence length 391
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3167:95918:111700:-1 gene:ENSGMOG00000002209 transcript:ENSGMOT00000002438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSGMWDKLMCWPSAGLEEVVTLPCPKYFSYFTNLSKTCTEDGWSTISPASYNLHCGFDSN
NTMDAEAVDLGDFYAAVKVGYTIGHSVSLIALTAAIILLCLFRKLHCTRNYIHMNLFVSF
VLKATSVFVKDVILYPGDQPEECPSSVGCKAVLVFFQYGIMASYFWLLVEGLYLYALLAV
SFFSEKKYFWCYILIGWGVPAIFISAWVGTKVYLKDPGCWDIIEGLPWWIIKTPILIAIL
VNFFLFICIIRILQQKINCPDIGRKESNQYSRLAKSTLLLIPLFGMNYIIFAYIPEHIQL
HVRMVFDLVLGSFQGFIVAVLYCFLNGEVQSEVRRKWRRWMLQRFLSTADTKYQPPSMGS
NGNNFSTQITMLTKCSPTTRRSSSCQDHLSA
Download sequence
Identical sequences ENSGMOP00000002359 ENSGMOP00000002359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]