SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002720 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002720
Domain Number 1 Region: 315-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-51
Family SPRY domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 120-183
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000198
Family B-box zinc-binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002720   Gene: ENSGMOG00000002582   Transcript: ENSGMOT00000002807
Sequence length 502
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2872:41093:42675:-1 gene:ENSGMOG00000002582 transcript:ENSGMOT00000002807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SICLDVLSNPVTTPCGHNFCRTCITQYWDEEVKYKCPFCNELFNTRPDVRVNILLSEMVD
RFGTSVRIKSSLVLPADVPCDVCTGNQLKAVKSCLVCFMSFCRTHLEPHQRVAVLKKHRL
VEPTDRLEDRMCKKHDRLLELFCQIEQVCVCLLCTEGHHRSHPVVSLKEEYEVKMAQLGK
IEAEVKQMIQERQENIQEIKDTVKRCIEKCQDDLNQMVKEKLKSTEKQAEHLIKKLEQEI
ENLTNRSSEVKQLSHTEDHLHFLQAFKSLKKPPPKRTWRMVEVRPPSYVGTLRRSLDQLE
ETLNMEMEKLRDGELKRVQQYEVDVTLDPDTANTSLILSEDGKQAHHGGVVKKLRDNPKR
FNKCAHMQSFSSGGFYFEVQVKDKTTWCLGVASESIKRKGHIIETPETGYWTLYSYKDVL
VFNDDPAVRLPLRAELQKVGVFVDYDEGLVSFYDVEARVKLYSATECTFTKPLYPILCPG
YCYFGGMNSSPLIISPVNQTES
Download sequence
Identical sequences ENSGMOP00000002720 ENSGMOP00000002720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]