SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002900 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002900
Domain Number 1 Region: 277-539
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-57
Family YWTD domain 0.00000000854
Further Details:      
 
Domain Number 2 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 3 Region: 36-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00048
Further Details:      
 
Domain Number 4 Region: 232-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.00084
Further Details:      
 
Domain Number 5 Region: 112-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00025
Further Details:      
 
Domain Number 6 Region: 153-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 7 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 78-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 9 Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002900   Gene: ENSGMOG00000002735   Transcript: ENSGMOT00000002991
Sequence length 781
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1395:160771:175155:1 gene:ENSGMOG00000002735 transcript:ENSGMOT00000002991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSSDFQCGTGVCISSRWVCDGANDCGDGSDELMGICMSRTCAPSEFSCGGRAVECIPKS
WHCDGKADCENAADEEGCAPLQCVEGEFRCETGRCLSHSLVCDGYDDCGDHTTCRPDQFE
CGDGSCIHGSQQCNQQYDCRDMSDEMGCVNASRCEAPSHFKCRSGECINMERTCDGHNDC
RDWSDEPVIECGTNECQLNNGGCSHACQDLRVGHACLCPAGYGLLDARRCGDIDECADPD
TCSQICVNQIGGYKCDCREGYQLEPSTKACKAIGTVAYLLFTNRHEVRRMTLDKSEYTRV
VPRLKNAVTLDLNIASNCVFWSDISEKTIYSATMDAAANATQHHVVIGNGIGAPEGIAVD
WVHGNLYWTDGMHSTISVATVDGSRRKTLIRQDLSRPRGIVVDPVHNFLYWTDWGTPAKI
EKAGLNGGDRIALVTDNIIWPNGITLDLLNQRLYWVDSKLHTLSSVDVNGGGRRTVLVDK
QRLAHPLGVTVFEDRVFWTDVSNNAIFSVNRLTGSDVRAVAEHLSSPDDIVMYHNLRQPA
XXDWCGTANGGCEFLCLAAPQVGPHPPKYTCACPDDMALARDMRRCVPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVMV
AAFVCFLLWRNFRLKNTNTIHFDNPVYQKTTEDQLHIYRSQSPDGYSYPPKQIVSLDEEA
D
Download sequence
Identical sequences ENSGMOP00000002900 ENSGMOP00000002900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]