SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002963 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002963
Domain Number 1 Region: 2-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.5e-75
Family BAR domain 0.0000000191
Further Details:      
 
Domain Number 2 Region: 269-331
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002963   Gene: ENSGMOG00000002808   Transcript: ENSGMOT00000003057
Sequence length 336
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3862:2397:8756:1 gene:ENSGMOG00000002808 transcript:ENSGMOT00000003057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVSEKVGGAEGTKLDDDFKEMEKKVDITSRAVLDIMTKTTEYLQPNPAHRARLSMISTMS
KFRGQEKGPGYPQAESVLGDAMQHFGRELGEESSFGVVMLDVGEAMRELGEVKDALDMEV
KQNFIDPLQNLHDKDVKEIQHHIKKMEGRRLDFDYKRKRMGKVQEEELRQALEKFDESKE
IAEQSMFNLIESDIEQVSQLAALLQAQLEYHSRSAEILKQLSSKMEDSIKEASSRPRKEF
TPKPRMTLELLPPSKSLNGGLHSAKSPSKSTAPLSQPCCRAIYDFEPENEGELGFKEGDI
ITLTNQIDDNWYEGTINGQSGFFPINYVDILVALPQ
Download sequence
Identical sequences ENSGMOP00000002963 ENSGMOP00000002963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]