SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003133 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003133
Domain Number 1 Region: 178-243
Classification Level Classification E-value
Superfamily Homeodomain-like 1.03e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.49e-16
Family LIM domain 0.0096
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000366
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003133
Domain Number - Region: 91-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00892
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003133   Gene: ENSGMOG00000002984   Transcript: ENSGMOT00000003231
Sequence length 407
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2720:539712:545765:-1 gene:ENSGMOG00000002984 transcript:ENSGMOT00000003231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCERPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRRFG
TKCAGCSQGISPNDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLN
NASVKDTNLLSVTACSDPSLSPDSQDQLQDDVNLKDSEIAALSDKETGNNENDDQNLGGK
RRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMK
QLSALGARRHAFFRSPRRMRTLVDRLEPGELIPNGPFSYYGDYQSEYYGPGGNYDFFPQG
PPSSQAQTPVDLAFVPSSGPTGTPLGGMEHPLPGHHPSSEVQRFSDIMSHHPGDSPSPEP
GIPGAMHGLSSEVFGPSPPFTSLSLNGSGYNSHLSHAPSEMNEGTVW
Download sequence
Identical sequences ENSGMOP00000003133 ENSGMOP00000003133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]