SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003656 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003656
Domain Number 1 Region: 44-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 128-175
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000105
Family Hairy Orange domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003656   Gene: ENSGMOG00000003444   Transcript: ENSGMOT00000003766
Sequence length 420
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1479:7439:11837:-1 gene:ENSGMOG00000003444 transcript:ENSGMOT00000003766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDRILRLEERQFMEHTDFLGMEYPSLYICKSKRAMKREDGGKQDAYKLPHRLIEKKRRD
RINECIGQLKDLLPDHLKLATLGHLEKAVVLELTLKHLNALTAVTEQQHHKIIALQSXGD
QPMKSSIHADLDAFQSGFQACAKEVLHYLNKFENWSSREQRCTQLVCHLHAVLAQLPPAG
GAPPRGGTQPELDAHRVDGQGDAQADGQADAQTDRPVIQRTGELNENDTDTDSGYGGEAE
KHGANKGCERAAKAQGGHRAVKIKQEFGDDRVAKKTKTSFSVNGLVGADPSRPDLALMSS
LMGLPGVGQHAPFCVPFYFINPSAAASYMPFFDKSNLDKYAYPAAAALTAPFPWLYPGRI
PGLSAEKRAGASPSPGTLSPDREAELCSPDDGEEGHESEDDEDDVRDMSNETKHNPYARS
Download sequence
Identical sequences ENSGMOP00000003656 ENSGMOP00000003656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]