SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004799 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004799
Domain Number 1 Region: 368-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-47
Family SPRY domain 0.0000243
Further Details:      
 
Domain Number 2 Region: 9-77
Classification Level Classification E-value
Superfamily RING/U-box 1.86e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 135-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004799   Gene: ENSGMOG00000004532   Transcript: ENSGMOT00000004940
Sequence length 531
Comment pep:novel scaffold:gadMor1:scaffold02682:5949:7905:1 gene:ENSGMOG00000004532 transcript:ENSGMOT00000004940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACANANWSEENFSCSICLDVFNSPVSTPCGHNFCRTCITKYWDGQVKYKCPVCNELFNT
RPDLRVNTLLSEMVDRFGTSVRVKSSLVEPAEVLCDFCTGTQKQAVKSCLVCFTSYCQTH
LEPHQRVTVLKKHRLVEPMDRLEDRMCTKHDRLLELFCQTKQVCVCQLCIETDHKSHPVV
PLKEEYEVKTAQLRKIEAEVQQIIQERKNIQGIKDTVXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLILSEDGKQVHDGDEEKELPDNPKRFTLCVNVLTRQSFSSGRFYFEVLVKDK
TGWDLGVARESVKRIGKIISSPERGYWTINSTGGLVFKDNPAVRLPLRAELQKVGVFVDY
DDGLVSFYDVDARVHLYSATGCTFSEPLYPFLSPGLNEGGTNSAPLIISPV
Download sequence
Identical sequences ENSGMOP00000004799 ENSGMOP00000004799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]