SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005262 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005262
Domain Number 1 Region: 351-529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-58
Family SPRY domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-18
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 3 Region: 135-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005262   Gene: ENSGMOG00000004978   Transcript: ENSGMOT00000005420
Sequence length 533
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4643:136797:138644:1 gene:ENSGMOG00000004978 transcript:ENSGMOT00000005420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASANISWSEENFSCPICLDVFSSPVSTPCGHNFCRTCINKFWDEQVQCKCPICNKIFDT
RPDPQVNILVSEMADQFRTAVRVKRSLVEPGEVPCDVCTGTQLKAVKSCLVCLISYCQTH
LEPHQRVAGLKKHRLVEPMDRLEDRMCKKHDRLLELFCKTEQECVCLFCTETDHKSHPVV
PLKEEYEVKTALLGKIEAEVQQMIQERKLKIKEIKDKVEFXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDLIKELEQEIEALTNRSSEVKPLSHTKDHLHFLQ
AFRSLKDPPPTRDWTTVEVRPPSYAGTLRRSLDQLEETLNMEMKKLRDAELKRVQQYEVD
VTLDPDTANHWLILSEDGKQVHHGDVQKKLPDNPKRFTWYTFVLTRQSFSSGRFYFEVQV
KAKTAWWLGVARKSIYRTGLTRRTPETGYWMMCWYLENPAVRLPLRAELQKVGVFVDYDE
GLVSFYDVEARVHIYSATGCAFTEPLYPLLSPWYHEGGTNSPPLIISPVNQKD
Download sequence
Identical sequences ENSGMOP00000005262 ENSGMOP00000005262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]