SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005316 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005316
Domain Number 1 Region: 46-117
Classification Level Classification E-value
Superfamily EF-hand 0.000000119
Family Calbindin D9K 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005316   Gene: ENSGMOG00000005029   Transcript: ENSGMOT00000005476
Sequence length 301
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1806:56245:57671:-1 gene:ENSGMOG00000005029 transcript:ENSGMOT00000005476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIDVNDPYGRPARRTQWIVSTLAFHYGLDRGVENEIIVLATGLDQYLQEIFHHMDYQG
SGKVHAEDFHVLCEVLGLNKDSDSESECGEEEVSENLPGELTFRQFHALLCGYFSTKAGC
QYENGRLLVGKDSEHIETQIRLRSPLRRRERLLSVSGGTRPRPEEGGQRRGRHEDRIAKI
EEENASLRELVEDMRAALQSSDARCLALQVGLWKSHGRHKPEEGCFIALQHQAAQEALAA
LEESNRTLKREQAGTRRRMEEARLAVLTGMGKVKQLEEKAGNVPVLERRVLRLEAELCYY
R
Download sequence
Identical sequences ENSGMOP00000005316 ENSGMOP00000005316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]