SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005911 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005911
Domain Number 1 Region: 179-264
Classification Level Classification E-value
Superfamily Immunoglobulin 6.19e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 281-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000248
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000005911
Domain Number - Region: 65-149
Classification Level Classification E-value
Superfamily TIMP-like 0.00902
Family The laminin-binding domain of agrin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005911   Gene: ENSGMOG00000005554   Transcript: ENSGMOT00000006084
Sequence length 769
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4069:43243:89402:1 gene:ENSGMOG00000005554 transcript:ENSGMOT00000006084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCRSALPAPPVPVRRRRRLSLPARPATQQHCSTAQADGMRLDPVHFSMLVIGVSFACYAP
SLNSLQDQAYRAAVVIEGEVRSSSPENATSREPYSVNVKVLDVWPINSGGLEKEQLVTVG
DFGSEAPCTTVEKDHRYIFFMDPTAEPLVFKASYAPVDASEPELKKDVERVLCEDCASAP
KLRPMQGQSLMEGDKLYLKCEASGSPSPSFHWYKDGLKLQKGRDLKIKTNKRKNSKVQIS
RVRVDDSGNYTCVAENSLGQENATXXXXXXXXXXXXSAGVSHTRRCNESERTYCVNGGDC
YFIHGINQLICKCPNDYTGDRCQNSVMAGFYSASQSAEAEELYQRRVLTITGICVALLVV
GIVCVVAYCKTKKQRQKMQNHLHQGQNQCVEQPNRTLANGPNHPGPGPEEIPMVDYISKS
VPTTECVISHGAEGAGNYAGSRMSTRSHHSSTASHASXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTP
ARLSPVEFHYPALPPQVPTFQITSHHTAHGLGLPPSSANATYHREDDQPLLRCPDXXXXX
XXXXXXXXXXXXXXXXXXXDGRLYRQPRRPRRSYLAESTGSLPSSPYRLPDEEAYETTQE
YASSREPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHGESTPFLSMQNMSVEP
PPLVLAPMGYRLSSGGDTRTHRAPSRGPGPRSNGQSRGGQRSKTDHMPL
Download sequence
Identical sequences ENSGMOP00000005911 ENSGMOP00000005911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]