SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005958 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005958
Domain Number 1 Region: 315-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-59
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-17
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 118-182
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000005958
Domain Number - Region: 183-243
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.00458
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005958   Gene: ENSGMOG00000005615   Transcript: ENSGMOT00000006132
Sequence length 503
Comment pep:novel scaffold:gadMor1:scaffold07418:4067:5653:1 gene:ENSGMOG00000005615 transcript:ENSGMOT00000006132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SICLDVFNNPVTTTCGHNFCRTCITKFWDEQIQYKCPVCNKLFSIRPDLQVNTFLSELAA
QFRQPSKPLFVEQAEVPCDFCTGTQLKAVKSCLECFMSYCQTHLEPHQRVARLQKHRLVE
PMDRLEDRMCKKHDRLLELFCQTEQECVCQFCTEGDHKSHPVVPLKEEYEVKTAQLGEIE
AEVQQMIQECKQKMKEITDTVEGCVEKCRDDFNQTVKEKLKSTEKQAEDLIKELEQEIED
LTNISSEMMKQLSHTEDHLHFLQAFRSLKDPQPPRDWTTVEVRPPSYAGTLWSSLDQLEE
TLNMEMEKLLKAELKSVQQYEVDVTLDPDTAHPRLILSEDGKQVHDGGVWKELPDNPKIF
TQYIHVLTRQSFSSGRFYFEVQVKDKTEWYLGVARESIDRISEILVTPETGYWTLYCDKN
GLFFRDNPFVCLPLRAELQKVGVFVDYDEGLVSFYDVEARVHIYSATGCAFTEPLYPFLC
PGRHDFGGNNSAPLIISPVNQTD
Download sequence
Identical sequences ENSGMOP00000005958 ENSGMOP00000005958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]