SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006052 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006052
Domain Number 1 Region: 229-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 2 Region: 97-161
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000608
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006052   Gene: ENSGMOG00000005673   Transcript: ENSGMOT00000006227
Sequence length 578
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1960:916962:922784:1 gene:ENSGMOG00000005673 transcript:ENSGMOT00000006227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKWDQPGPGSGSGSGGMGEVETAPTGALDAAAAVAAKINAMLVAKGKLRPSQIGVPGPLD
KVVGVCKPAMQTKAKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISKISGAAVSTRGRYM
AADEKGKALSGERPLYLHVQGQTRELVDRAVNRIKEIITNGLVKAVAATTASSSYSHSPA
APAPVYQPHKPPPVSMAPMSHGHKPHYQSGMHYVQDKLFVGLEHAIQGFPVKEKVEGPGC
SYLQHIQAETGAKVFLRGKGSGCLEPTSGREAFEPMYIYISHPKPEGLAAAKTLCQNLLQ
TVHAEYSNFLNQMSSMMPPQDLSLPPPGYMPPIAVNAYYPPAGYQPSYPMPVPPPRPSPY
AVPPPIPLAAPSVVPPVQPPARLPALFPPDATGKPVPSFSPAVPALPKATNPPQKRRFTE
EVPDERDSGLLGYQHGPIHMTNLGAGFPVGSPETSGPLSQSSSSAPNERDSRQLMTPLPM
SLNGGMRPKMEEMRALQGPLEPSVKRVKTGLVAYTGDSSDEEEEHRSAPRALGTGNPGLA
PSSPSWTQGYRGLTPAAPRDKAQTHHQQQPPMPFWMAP
Download sequence
Identical sequences ENSGMOP00000006052 ENSGMOP00000006052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]