SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006360 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006360
Domain Number 1 Region: 352-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-53
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily RING/U-box 5.42e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 134-192
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000351
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006360   Gene: ENSGMOG00000005987   Transcript: ENSGMOT00000006546
Sequence length 522
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2076:154813:158104:1 gene:ENSGMOG00000005987 transcript:ENSGMOT00000006546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTSISIEEDQFSCPVCLDFLRDPVTIPCGHSYCLDCIDDYWTRNKNKGYFGCPQCRQ
LFNPRPALSRNTVLSEVVDQIQQAKAEQVVLCGVCSGSRKREAVKSCLACLESYCVAHLG
VHDDQFRGNAHKLTTPLARVRDKLCRHHDKVLREYCWTDQQCVCAQCVRHKHRGHDTVPL
AEARATHERKLADASFKSLQKYKEIKKELKYIVNYIKHSTQAVMDESERTFSKLARLIEK
HRSEVRKLIRSQEQTVLQETDELLGKLERESKELKRRGAELEELSNTDDHLQFLQKCKSF
HFPAETVDLPSTDVLPYRMYKSMRGALVELRAALAEVCENELLRVSDKDNHDLSLDSSTA
NPYLILSDGRRGVTTWSEAQPYPENPGRFTRWAQVLCRAGMAGRCYWEVEWSGVGGVSVG
LCYKSMAREGAGSDCKLGHNSKSWSLDCSPSACSFQHDKDTVAIAVPCANRIGVYMDYRA
GILSFYSIPDGMILLHTVRTTFTQPLYPGFWVGLGSTLRLCP
Download sequence
Identical sequences ENSGMOP00000006360 ENSGMOP00000006360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]