SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006461 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006461
Domain Number 1 Region: 94-197
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000471
Family Polyphosphate kinase C-terminal domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006461   Gene: ENSGMOG00000006094   Transcript: ENSGMOT00000006653
Sequence length 208
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4487:94520:98199:1 gene:ENSGMOG00000006094 transcript:ENSGMOT00000006653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESQLMCMEDGQIRPAVPENKPEFYYSEAQRAAVEELLKNGDGAFKTRLKEDKANDFLS
AREVVFARQFKDNTNADLKVHAKAEGSSGDSGLHSTYWPQMSDTDVPPLDIGWPSGGFFR
GVTRVAVHTHPPKDNGPHIKEVVRRMIQEASKVVAIVMDLLTDLHILQDLMEAASRRSVP
VYILLDASGMPHFLDMCCRLQMGSQHLR
Download sequence
Identical sequences ENSGMOP00000006461 ENSGMOP00000006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]